SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000405708 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  HGL_H00000405708
Domain Number - Region: 664-853
Classification Level Classification E-value
Superfamily Tropomyosin 0.000399
Family Tropomyosin 0.0068
Further Details:      
 
Domain Number - Region: 24-58
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.011
Family Myosin rod fragments 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000405708
Sequence length 941
Comment CCDC39 (Homo_sapiens) coiled-coil domain containing 39
Sequence
MSREFLAELHWEDGFALPVSNEGNKMLENQLSKLQNEKSNLEDQLHDYEDRINAMNSHFK
NVKQEFSFTQSLYKAKENEIESEEHFKAIAERELGRVKSEILRLENEIVSIRERKTDKEN
GIFKATQKLDGLKCQMNWDQQALEAWLEESAHKDSDAFTLQKYAQQDDNKIRALTLKLER
LTLECNQKRKVLDNELTETLSAQLELDKAAQDFQKIHNERQELIEQWENTIEQMQKRDRD
IDDCALALTRIKQETREKESLVKEKVKFLENEIGNNTEYEKRISAADREVLKCRTEYQNH
ESSRSQLKDELDSLKATVNRTSSDLEALRKNISKIKKDSHEERQRLQKIKNHNQIISKKL
NHITEKTMSVEEKATNLEDMLKEQEKGVKEVEVRLNIVKDVLFKKVQELQTEMMKEKAVV
SEIEGTRSTLKHLNNQLHKLDFETLKQQEIMYSQDFYIQQVERRMSQLKGEINSEEKQAL
EAKIVEFKKSLEEKKSTFDLLETQIKKLHNDLYFIKKSNSKNCDEKQSLLTKINELNLFI
NSSEKELNKAKVFKQDLMIEDNLLKLEVKRTREMLHSKAEEVLSLEKRKQQLLTAMEERT
EEIKVHKMMLASQIRYVDQERQNISGEFHERLSKIDKLKNRYEILTVVMLPPEGEEEKTQ
AYYVIKAAQEKEELQREGDSLDAKINKAEKEIYALGNTLQVLNSCNRNYKHSFKKVTPSS
DEYQLKIQLEEQRRAADEKYRYKQRQIRELQEDIQSMENTLQLTEHLANNVKEKLSEKQA
FASQVHRETEEQKPKLERVTKQCAKLTKDIRLLKQTKDETPEEQDIKVREVKQFQKVIDE
MLVDCIKENAAIRFILQTYFKQNGLELPIASSKESHQSSTSSQASLVSPRSSRSSINTSA
SQASIKVLELNFPDSSPVGSNSRPIRASSSSSNLKSNKSGK
Download sequence
Identical sequences G5BKA2
HGL_H00000405708 XP_004834705.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]