SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000405738 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000405738
Domain Number 1 Region: 217-384
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.06e-17
Family Canonical RBD 0.00079
Further Details:      
 
Domain Number 2 Region: 432-525
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 8.06e-17
Family Canonical RBD 0.0016
Further Details:      
 
Weak hits

Sequence:  HGL_H00000405738
Domain Number - Region: 622-655
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0208
Family Canonical RBD 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000405738
Sequence length 677
Comment ESRP1 (Homo_sapiens) epithelial splicing regulatory protein 1
Sequence
MTASPDYLVVLFGITAGATGARLGSDEKELILLLWKVVDLANKKVISPRVLSRGEEWGEK
FGEARVGKARSLFPSLCLLFQFNQSVSNELNIGVGTSFCVCTDGQLHIRQILHPEASKKN
VLLPECFYSFFDLRKEFKKCCPSSPDIDKLDVAAMTECLNFEKSGSDSRYGASQVEDMGN
IILAMISEPYNHRFSDPERVNYKFESGTCSKMELIDDNTVVRARGLPWQSSDQDIARFFK
GLNIAKGGAALCLNAQGRRNGEALVRFVSEEHRDLALQRHKHHMGTRYIEVYKATGEDFL
KIAGGTSNEVAQFLSKENQVIVRMRGLPFTATAEEVVAFFGQHCPITGGKEGILFVTYPD
GRPTGDAFVLFACEEYAQNALRKHKDLLGKRYIELFRSTAAEVQVVQVLNRFSSAPLIPL
PTPPIIPVLPQQFVPPTNVRDCIRLRGLPYAATIEDILDFLGEFSTDIRTHGVHMVLNHQ
GRPSGDAFIQMKSADRAFMASQKCHKKTMKDRYVEVFQCSAEEMNFVLMGGTLNRNGLSP
PPCKLPCLSPPSYTFPAPAAVIPTEAAIYQPSVLLNPRALPPSTAYYPAGTQLFMNYTAY
YPSPPGSPNSLGYFPTAANLSSVPPQPGTVVRMQGLAYNTGVKEILNFFQGYQYATEDGL
AHTNDQARTLPKEWVCI
Download sequence
Identical sequences G5C4C2
HGL_H00000405738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]