SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000406383 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000406383
Domain Number 1 Region: 528-561,629-681,711-1181
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 4.39e-89
Family DNA polymerase I 0.00031
Further Details:      
 
Domain Number 2 Region: 79-173,216-509
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.28e-78
Family DnaQ-like 3'-5' exonuclease 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000406383
Sequence length 2300
Comment POLE (Homo_sapiens) polymerase (DNA directed), epsilon
Sequence
MVLRDGGRWLVEPGADAEASRDDGPSSSVSALKRLERSQWMDKMDLRFGFERLKAPDEKT
GWLINMHPTEILDEDKRLVSAVDYYFIQDDGSRFKVALPYKPYFYIATRKGCEREVSSFV
SKKFQGKIAKVETVPKEDLDLPNHLVGLKRSYIKLSFHTVEDLVKVRKEVSPAVKKNREQ
DHASDTYTSMLSSVLQGGSVIADEEETSKKIADQLDNIVDMREYDVPYHIRLSIDLKIHV
AHWYNVRYRGNAFPVEITRRDDLVERPDPVVLAFDIETTKLPLKFPDAETDQIMMISYMI
DGQGYLITNREIVSEDIEDFEFTPKPEYEGPFCVFNEPDEVHLIQRWFEHIQETKPTIVV
TYNGDFFDWPFVEARAAAHGLSMYQEIGFQKDSQGEYKAPQCIHMDCLRWVKRDSYLPVG
SHNLKAAAKAKLGYDPVELDPEDMCRMATEQPQARPWVLTAELWFSPQALATYSVSDAVA
TYYLYMKYVHPFIFALCTIIPMEPDEVLRKGSGTLCEALLMVQAFHANIIFPNKQEQEFN
KLTDDGHVLDAETYVGGHVEALESGVFRSDIPCRFRMNPAAFDFLLQRVEKTMRHAIEEE
EKVPLEQATNFQEVCEQIKTKLTSLKDVPNRIECPLIYHLDVGAMYPNIILTNRLQPSAM
VDEATCAACDFNRPGANCQRKMAWQWRGEFMPASRSEYHRIQHQLESEKFPPLFPEGPAR
AFHELSREEQAKYEKRRLADYCRKAYKKIHVTKVEERLTTICQRENSFYVDTVRAFRDRR
YEFKGLHKVWKKKLSAAVEAGDAAEVKRCKNMEVLYDSLQLAHKCILNSFYGYVMRKGAR
WYSMEMAGIVCFTGANIITQARELIEQIGRPLELDTDGIWCVLPNSFPENFVIKTTNLKK
PKVTVSYPGAMLNIMVKEGFTNDQYQELAEPSSLTYVTRSENSIFFEVDGPYLAMILPAS
KEEGKKLKKRYAVFNEDGSLAELKGFEVKRRGELQLIKIFQSSVFEAFLKGSTLEEVYSS
VAKVADYWLDVLYSKAANMPDSELFELISENRSMSRKLEDYGEQKSTSISTAKRLAEFLG
DQMVKDAGLSCRYIISRKPEGSPVTERAIPLAIFQAEPTIRKHFLRKWLKSSSLQDFDIR
TILDWDYYIERLGSAVQKIITIPAALQQVKNPVPRVKHPDWLHKKLLEKSDIYKQKKISE
LFVLEGKRQIVMAQAPEGSARPGAPDIEDFGISKPPHPMVPVATKRKRVLWESQEESQDL
MLIVPWQEILGQPPTLGTTQEEWLVWLQFHKKKWQLQARQRLAQRKRQRLESVKGALRHA
ALRDGPAMGLGSFLQRTARSVLDLPWQIVQISETSQTGLFRLWAVIGSDLHCIKLSIPRV
FYVNQRVARAEEGVTCRKVNRVLPRSNLVYNLYEYSVPEAMYQEHINEINTELSAPDIEG
VYETQVPLLFRALVQLGCVCVVNKQLVRHLSGWETDTFALEHLEMRSLAQFSYLEPGSIR
HIYLYHHSQGHKALFGIFIPSQRRASVFVLDTVRSNQMPNLGTLYSVEHSLLLEKVGPEL
LPPPKHTFEVRAETDLKTICRAMQRFLLAYKEDRRGPTLIAVQSSWELRRLASEVPVLEE
FPLVPMRVADKISYGILDWQRHGARRMIRHYLNLDTCLSQAFEMSRYFHIPIGNLPEDIS
TFGSDLFFARHLQRHNHLLWLSPTARPDLGGKEADDNRLVMEFDDRATVEINSSGCYSTV
CVELDLQNLAVNTILQSHHVNDMEGASSMGISFDVIQQASLEDMVTGNQASAPASYDEAA
LCSSTFRILKSMVVGWVKEIMQYHNIYADNQVMHFYRWLRSPCSLLHDPALHRTLHNLMK
KLFLQLIAEFKRLGSSVIYANFNRIILCTKKRRIEDAIAYVEYITNSIHSKEIFHSLTIT
FSRCWEFLLWMDPSNYGGIKGKVPSSVHCGQQDSQKREGAEDEQEDEEDQEEEPEEEEQG
VEESDVEDLLENNWNILQFLPQAASCQSYFLMIVSAYIVAVYHSMKGELRHSAPGSTPVK
RRGPSQFSQETEGTAGALPGVITFSQDYVANELTQNFFTITQKIQKKVTGSRHSTKPSEM
FPLLPGSHLLLNNPALEFIKYVCKVLSLDTNISNQVNKLNRDLLRLVDVGEFSEEAQFRD
PCRSYVLPEVICCNCNFCRDLDLCKDSSFSQDGAVLPQWICSNCQAAYDSATIEAALVEA
LQRKLMAFTLQDLVCQKCGGVKETHMPVYCSCAGDFALTIHTQIFMDQISIFQNIAQHYD
MSYLMETLEWLLQKGPQVGP
Download sequence
Identical sequences G5ANV9
HGL_H00000406383

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]