SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000406754 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000406754
Domain Number 1 Region: 220-528
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.61e-74
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000192
Further Details:      
 
Weak hits

Sequence:  HGL_H00000406754
Domain Number - Region: 58-120
Classification Level Classification E-value
Superfamily tRNA-binding arm 0.000115
Family Seryl-tRNA synthetase (SerRS) 0.0078
Further Details:      
 
Domain Number - Region: 165-217
Classification Level Classification E-value
Superfamily tRNA-binding arm 0.000392
Family Seryl-tRNA synthetase (SerRS) 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000406754
Sequence length 556
Comment FBXO17 (Homo_sapiens) F-box protein 17
Sequence
MAASVARRLWPLLARRGLWPRGECVYDQSPGRNFATEKRGRNLLYEHAREGYSALPHLDM
KLLCACPEEVARALELRKGGLRPADLPRIISTWQELRQLREQIQNLETEKSTVAEAVRAL
LTHLLICQWAPTAAEWAMMQETVSSPQSFVEAAHRTLLLVNQDHSQVQQDPQYKALRTRG
REIRKQLVLLYPREDQLEEQFYLQALKLPNQTHPDVPAGDESQARVLQVVGEKPAFSFQP
RGHVEIGEKLDIIRQKRLSHVSGHRSYYLRGAGALLQHSLVSFTLSKLVGRGFTPMTVPD
LLRGAVFEGCGMTPNASPSHVYSIDPSHFEDLHLAGTGEVGLAGYFMDHSVAFRDLPVRM
VCSSTCYRAETDTGREPRGLYRVHHFTKVEMFGVTGPGLEQSSQLLKEFLSLQVEILTEL
GLHFRVLDMPTQELGLPAYRKFDIEAWMPGRGRFGEVTSASNCTDFQSRRLHIMFHTEAG
ELCFAHTVNATACAIPRVLIALLESNQQKDGSVLVPPALQPYLGTDRITAPTHDPLQYIG
PNQPQKPRLPDPSASG
Download sequence
Identical sequences G5AM99
HGL_H00000406754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]