SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000406956 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000406956
Domain Number 1 Region: 519-971
Classification Level Classification E-value
Superfamily Ribonuclease H-like 3.79e-135
Family PIWI domain 0.014
Further Details:      
 
Domain Number 2 Region: 229-543
Classification Level Classification E-value
Superfamily PAZ domain 1.11e-75
Family PAZ domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000406956
Sequence length 971
Comment PIWIL2 (Homo_sapiens) piwi-like 2 (Drosophila)
Sequence
MDPVRPPFRAPAPVHPSQCVRMPGCWPQAPRPLNLALGRAGPTGRGYVFGKPEVPTTQNQ
PAQRECIGLVSMFRGMGLEMVSPTPLKREVPSLGRGILGRGLSANMVHKDKEEPRPAFPD
PLVLAAGNSKLAEATVGWNRILGRGSSDASSLPLGRTAGSIGRGVDKHLQTPGLTARDPQ
QLSPPKPLPRSSLNSPDHSSGPTVEHKEREHFVKQGSKGTPQSLGLNLIKIQCHNEAVYQ
YHVTFSPNIECKSMRFGMLKDHQAVTGNVTAFDGSILYLPIKLQQVLELKSQRKTDDAEI
SIKIQLTKILEPCSDLCIPFYNVVFRRVMKLLDMKPVGRNFYDPTSAMVLQQHRLQIWPG
YAASIRRTDGGLFLLVDVSHKVIRNDSVLDFMHAMYQQSKENFQDECSKFLVGSIVITRY
NNRTYRIDDVDWNKTPKDSFTMSDGKEITFLEYYRKNYGITVKEEDQPLLIHRPSERQNK
HGTLLKGEILLLPELSFMTGIPEKMKKDFRAMKDLTQQINLSPKQHHKALECLIQKILKN
ETANNELMRWGLCLQKDIHKIEGRVLPMERINLRNTSFITSQELSFVKEVTRDPSILTIP
MHFWALFYPKKAMDQARELVNMLEKIAGPIGMHMSPPAWVELKDDRIETYIRTIQSVLGV
EGKIQVVVCIITGTRDDLYGAIKKLCCVQSPVPSQVINVRTIGQPARLRSVAQKILLQIN
CKLGGELWGVDIPLKQLMVIGMDVYHDPSRGMRSVVGFVASINLTLTKWYSRVVFQMPHQ
EIVDSLKLCLVSALKKFYEVNHCLPEKIVVYRDGVSDGQLKTVANYEIAQLQKCFESFEN
YQPKMVVFVVQKKISTNLYLAAPEHFMTPLPGTVVDHTVTSCDWVDFYLLAHHVRQGCGI
PTHYICVFNTTNLSPDHMQRLTFKLCHLYWNWPGTIRVPAPCKYAHKLAFLSGQILHHEP
AIQLCENLFFL
Download sequence
Identical sequences G5B9Q3
XP_004848356.1.39548 HGL_H00000406956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]