SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000407039 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000407039
Domain Number 1 Region: 394-451
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.16e-25
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 2 Region: 282-339
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.75e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 3 Region: 339-395
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.33e-23
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 4 Region: 562-619
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.18e-23
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 5 Region: 226-283
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.19e-22
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 6 Region: 451-507
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.84e-22
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 7 Region: 506-563
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.39e-21
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 8 Region: 604-656
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.66e-20
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 9 Region: 1-45
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.44e-18
Family KRAB domain (Kruppel-associated box) 0.0018
Further Details:      
 
Domain Number 10 Region: 192-240
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000591
Family Classic zinc finger, C2H2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000407039
Sequence length 663
Comment ZNF418 (Homo_sapiens) zinc finger protein 418
Sequence
QGHVTFEDIAVYFSQEEWGLLDETQRFLYLDVMLENFALTTSLVCGQETEDGEAPSVQSV
SVEVASQVKTLKAGPSTQKAHACDICVPALKDILHRDDLPGRKQCFVRACTNHLQEQKHH
STENLLKRDPVSASFVKSCLFHVSGNSLFCRNIGQDFSAKWSCLQAIPKDQKPNKVTTGV
EAIHTGKSYCKSNQCQKAPSPKHSFVQHPKVINAERYFESSKCGKAFQDKYSLVPLQRIH
TVERPYDCSECGKSFSQKATLIVHQRVHTGEKPYTCSECGKSFSQSSNLIEHCRIHSGER
PYVCGQCGKAFGCKSNLVRHQRTHTGERPYECAECGKFFRQSFSLVEHQRIHTTERPYEC
SHCEKSFSQKATLIIHQRVHTGERPYKCGECGKSFSQSSNLIEHCRIHTGERPYECGECG
KSFSQRATLIRHQRIHTGERPYECGECGKFFRQNFSLIEHRRIHMTTKIYECSQCGKSFS
QRATLIRHQRVHTGERPYECSQCGKAFGYKSKLDRHQRIHTGERPYECVECGKFFRQSYS
LVEHQRIHTRTRPYECGQCSKSFSRRAAFIKHQRVHTGERPYKCGECEKTFSRSTSLIQH
CRIHTGERPYECGQCGKSFRQKSVLIQHQVVHTGERPYECSKCRKSFSQRSSFFQHQKCH
HGE
Download sequence
Identical sequences G5B7M7
HGL_H00000407039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]