SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000408089 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000408089
Domain Number 1 Region: 43-204,242-367
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 6.8e-62
Family FCH domain 0.0024
Further Details:      
 
Domain Number 2 Region: 513-698
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.69e-51
Family BCR-homology GTPase activation domain (BH-domain) 0.0001
Further Details:      
 
Domain Number 3 Region: 750-805
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000021
Family SH3-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000408089
Sequence length 1091
Comment SRGAP2 (Homo_sapiens) SLIT-ROBO Rho GTPase activating protein 2
Sequence
MQQVAPWLGFAALQTGEGPGSLEDVGLQLSQEEWFLGGRNRKIRAQLTEQMKCLDQQCEL
RVQLLQDLQDFFRKKAEIETDYSRNLEKLAERFLAKTRSTKDQQFKKDQNVLSPVNCWNL
LLNQVKRESRDHTTLSDIYLNNIIPRFVQVSEDSGRLFKKSKEVGQQLQDDLMKVLNELY
SVMKTYHMYNADSISAQSKLKEAEKQEEKQIGKSVKQEDRQTPRSPDSTANVRIEEKHVR
RSSVKKIEKMKEKRQAKYTENKLKAIKARNEYLLALEATNASVFKYYIHDLSDLIDQCCD
LGYHASLNRALRTFLSAELNLEQSKHEGLDAIENAVENLDATSDKQRLMEMYNNVFCPPM
KFEFQPHMGDMASQLCAQQPVQSELVQRCQQLQSRLSTLKIENEEVKKTMEATLQTIQDI
VTVEDFDVSDCFQYSNSMESVKSTVSETFMSKPSIAKRRANQQETEQFYFTKMKEYLEGR
NLITKLQAKHDLLQKTLGESQRTDCSLARRSSTVRKQDSSQAIPLVVESCIRFISRHGLQ
HEGIFRVSGSQVEVNDIKNAFERGEDPLAGDQNDHDMDSIAGVLKLHFRGLEHPLFPKDV
FHDLMACVTMDNLQERALHIRKVLLALPKTTLIIMRYLFAFLSHLSQFSEENMMDPYNLA
ICFGPSLMSVPEGHDQVSCQAHVNELIKTIIIQHENIFPNPRELEGPIYSRGGSMEDYCD
SPHGETTSAEDSTQDVTTEHHTSDDECDPIEAIARFDYVGRTARELSFRKGASLLLYQRA
SDDWWEGRHNGIDGLIPHQYIVVQDTEDGVVERSSPKSEIEVLSEPPEEKVTPRVGASCP
GGGHVADIYLANINKQRKRPEPGSIRKTFRSDSHGLSSSLTDSSPGVGASCRPSSQPILS
QSLPKEGPDKCPISGHGSLNSISRHSSLKNRLDSPQIRKAATAGRSRSFNNHRPTDPEVV
AQDIEATMNSALNELRELERQSSAKHTPDVVLDTLEPLKTSPVAAPTSEPSSPLHTQLLK
DPEPAFQRSASASTAGDMACAFRPVKSVKMAAPVKPPATRPKPAVFPKTNATSPGVNSSA
SPQSTDKSCTV
Download sequence
Identical sequences G5BX57
HGL_H00000408089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]