SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000408168 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000408168
Domain Number 1 Region: 359-416
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.51e-25
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 2 Region: 415-472
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.84e-25
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 3 Region: 303-360
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.49e-24
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 4 Region: 461-513
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.78e-21
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 5 Region: 238-290
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.97e-19
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 6 Region: 37-87
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.66e-18
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 
Weak hits

Sequence:  HGL_H00000408168
Domain Number - Region: 195-249
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000387
Family Classic zinc finger, C2H2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000408168
Sequence length 518
Comment ZNF286A (Homo_sapiens) zinc finger protein 286A
Sequence
METDLAQMPEKKAISSQNSSQEKKPDEGEVTALRLTARSQETVTFKDVAMDFTPEEWGKL
DPAQRDVMLENYRNLVSLWLPVSKPENYNLDNGMEPLKFERKPPKRSYSDMESIPESKDS
TSVQDFSKEESCQDVIMDRLTRNSVYDSTLETALECENWLENQQGNQERHLRQVFTHMNS
FVEERNQHDIYWKNFSHKSVLITQDRVPRGSYPFHTLGTRLKQKSSLMKKQRTYKEKKPH
KCNDCGELFTYHSVLIRHQRVHTGEKPYTCNECGKSFSHRANLTKHQRTHNRVLFECSEC
KKTFTESSSLAIHQRIHIGERPYECSECGKGFNRSTHLAQHQLIHTGVKPYECSECDKAF
IHSSALIKHQRTHTGEKPYKCLECGKAFSHCSSLTKHQRVHTGEKPYECTECGKTFSQST
HLVQHQRIHTGEKPYECSECGKTFSRSSNFAKHQRIHIGKKPYKCSECEKAFIHSSALIQ
HQRTHTGEKPFKCNDCGKSFKCSSSLIRHQRIHTEEQP
Download sequence
Identical sequences G5BQZ6
XP_012923263.1.39548 XP_012923264.1.39548 HGL_H00000408168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]