SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000408239 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000408239
Domain Number 1 Region: 189-369
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.26e-47
Family Canonical RBD 0.0011
Further Details:      
 
Domain Number 2 Region: 11-178
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.49e-45
Family Canonical RBD 0.0000754
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000408239
Sequence length 370
Comment PABPC4L (Homo_sapiens) poly(A) binding protein, cytoplasmic 4-like
Sequence
MNAAAKYRLASLYVGDLHAEATEDLLFRKFSAAGPVLSIRICRDLATRQPLGYAYVNFLQ
LADAQRALDTMNFDVIKGRPIRLMWSQRDACLRRSGIGNVFVKNLDRSVDNKTLYEHFSG
FGKILSSKVMSDDQGSKGYAFVHFQSQSAANCAIEQMNGKVINDRPVFVAPFKPRKDREA
ELRSRASEFTNVYIKNFGDDMDDERLQGVFSRYGKTLSVKVMTDSSGKSKGFGFVSFESH
EAAKRAVEEMNGKDMNGQLVFVGRAQKKVERQAELKHMFEQMKKERIRRCQGVKLYVKNL
DDTVDDEQLRKEFSSFGSITRVKVMKEEGYSRGFGLICFSSPEEAAKALTEMNGRVLGSK
ALSIALAQRP
Download sequence
Identical sequences G5BK59
XP_004855027.1.39548 HGL_H00000408239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]