SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000408348 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000408348
Domain Number 1 Region: 532-615
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 0.0000144
Family Mannose 6-phosphate receptor domain 0.0094
Further Details:      
 
Domain Number 2 Region: 68-108
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000432
Family LDL receptor-like module 0.0049
Further Details:      
 
Weak hits

Sequence:  HGL_H00000408348
Domain Number - Region: 260-303
Classification Level Classification E-value
Superfamily EF-hand 0.000135
Family Calmodulin-like 0.056
Further Details:      
 
Domain Number - Region: 31-66
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000209
Family LDL receptor-like module 0.0044
Further Details:      
 
Domain Number - Region: 127-189
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00068
Family FCH domain 0.033
Further Details:      
 
Domain Number - Region: 404-509
Classification Level Classification E-value
Superfamily Tropomyosin 0.0304
Family Tropomyosin 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000408348
Sequence length 627
Comment PRKCSH (Homo_sapiens) protein kinase C substrate 80K-H
Sequence
MLLLMLLMLPLCWSVEVKRPRGVSLTNHHFYDKSKPFTCLDGSATIPFDQVNDDYCDCKD
GSDEPGTAACPNGNFHCTNTGYKPLYIPSSRVNDGICDCCDGTDEYNSGTVCENTCKEKG
LKERESLQQMAEVTREGFRLKKILVEDWKKAREEKQKKLTELQAGKKSLEDQVEALRALK
EEAEKPEKEAKEQHQRLWEGSITFLLSEGRDPCHLVPSAVTGPDAQWEPGLGWRELVAPG
AHGSWSCSSTEQQAAVKAQREQEQAADAFRELDDDMDGVVSVAELQTHPELDTDGDGTVS
EGEAQSEALEPRAGHRGTGRPRPDPTLTHTQGLLGGDTQTDASSFYDRVWASIRDKYRSE
ALLGGDTQTDASSFYDRVWASIRDKYRSEALPADLPAPLAPEVMESKEEQPSVPTHPTEY
EEEEEEETEEEEEDEEQDSEVPGEQPKEAPSPLEPSQPPSPSEEDKMPPYDEQTQAFIDA
AQEARSKFEEAERSLKDMEESIRNLEQEISFDFGPQGEFAYLYSQCYELSTNEYIYRLCP
FKLVSQKPKLGGSPTNLGVGGPAPTGPREHPVRLWSCRQVRLLCGKETAVTSTTEPSRCE
YLMELSTPAACPEPPPELPVDSDHDEL
Download sequence
Identical sequences G5BUJ8
HGL_H00000408348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]