SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000409204 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  HGL_H00000409204
Domain Number - Region: 184-249
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00698
Family Voltage-gated potassium channels 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000409204
Sequence length 733
Comment SUN2 (Homo_sapiens) Sad1 and UNC84 domain containing 2
Sequence
MSRRSQRLTRYSQGDDDGGSSSSGGSSVAGSQSTLFKDSPLRTLKKKSSNMKRMSPAPQL
GPSSDTHTSYYSESVIQESYIGSPRASSLARSALLDDHLRSEPYWDEDLRVRRRRGTGGT
ESSKANGLVESKATEDFLGSSSGYSSEDDFAGYSDMDQHSSGSSLGSVVSRAGSFVWTVI
TFPGRLFRLLYWWVGTTWYRLTTAASLLDVFVLTRRFSMLRTFLWFLLLLLLLTGLTYGA
WYFYPFGLQTSHPAVVSWWAARDSRRQPEVWDSRDTTPHFQGEQHILSRVHSLERRLEAL
AAEFSSSWQKQSIRLERLELWQGSTGHRGGGGLNHEDTLALLEGLVSRREAALKEDFLRD
TATRIQEELATVRAEHHHDSEDLFKKIVQASQESEARLQQLKSEWQRMTQENSVLWENIR
KNSVEELGRMEAQLTGLRQELAALSLKQSEVEDEVGLLPQKIQAVREDVESQFPAWVGHF
LLHGGGTRAGLLQREEVQAQLQELESKILTHVTEMQGKSTQEAAALLGQTLQKEGMVGVT
EEQVHQIVKQALQRYSEDRIGMVDYALESGGASVISTRCSEPYETKTALLSLFGIPLWYH
SQSPRVILQPDVHPGNCWAFQGPQGFAVVRLSARIRPTAVTLEHVPKALSPNSTISSAPK
DFSIFGFDEDLQQEGTLLGTFTYNQDGEPIQTFHFQTPKMAEYQVVELRILTNWGHPEYT
CIYRFRVHGEPAH
Download sequence
Identical sequences G5AYT8
XP_004845652.1.39548 HGL_H00000409204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]