SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000409315 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000409315
Domain Number 1 Region: 21-113
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.55e-23
Family Canonical RBD 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000409315
Sequence length 190
Comment RBM18 (Homo_sapiens) RNA binding motif protein 18
Sequence
MEAETKTLPLENASILSEGSLQEGHRLWIGNLDPKITEYHLLKLLQKFGKVKQFDFLFHK
SGALEGQPRGYCFVNFETKQEAEQAIQCLNGKLALSKKLVVRWAHAQIKRYDHNKNDKIL
PISLEPSSSTEPTQSNLSVTAKIKAIEAKLKMMAENPDAEYPAAPVYSYFKPPDKKRTTP
YSRTAWKSRR
Download sequence
Identical sequences A0A091DMX1 G5AJL7
XP_004641550.1.9945 XP_004849489.1.39548 XP_004849490.1.39548 XP_010601269.1.5607 XP_010601271.1.5607 HGL_H00000409315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]