SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000409514-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000409514-1
Domain Number 1 Region: 324-381
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1e-24
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 2 Region: 464-521
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.31e-24
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 3 Region: 408-465
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.84e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 4 Region: 1-56
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.62e-22
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 5 Region: 268-325
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.42e-22
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 6 Region: 371-403
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000119
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 7 Region: 510-550
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000169
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Weak hits

Sequence:  HGL_H00000409514-1
Domain Number - Region: 155-202
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0114
Family Classic zinc finger, C2H2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000409514-1
Sequence length 551
Comment MIR4273 (Homo_sapiens) microRNA 4273
Sequence
VSFEDVVVDFTCEEWQDLDDAQRTLYRDVMLETYRSLVLLGHCITKPEVIFKLEQGAEPW
MGEPPPNLSPPDGQKMDDIIQTTHQSGDRHVWQVVITTKNTTEEQVELRNTFDLSSSHIS
DLIISDGSYSVLKPEELNACQNTHLSSEPGEMDAGEKPNQCHITGKTLRCPEHFSPHPKM
PTGQQDFQYSGQWKAFTREAKLLKECITHKRVCMGQACWEHNESGKACEKSALIVKAGRK
TLYKNCDLTKHQTHTGEKSCDCLECEKTFITKLDLIIHQKKHSGKKRYACNQCEKSFSYK
SDLIVHERIHTGEKPYACNKCGKTFSRKSTLTIHEVIHTGKKPYECHECGKTFHQKSNLT
SHLRTHTGEKPYECNECGKAFGQKSNLRTHQCIHTGEKPYECKECRRSFYHKPALTIHER
THTGEKPYECNECGKTFCQKSYIRKHQRTHTGEKPYECNDCGKTFGQKSYLSKHEIIHTG
KRPYECNQCGITFSQKSNLSRHQRTHTGEKPFECNECGKTFGQKSSLTVHQSSHKGQKPY
ERQQYRRGFFH
Download sequence
Identical sequences G5ASR7
HGL_H00000409514-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]