SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000409514-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000409514-2
Domain Number 1 Region: 462-519
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.26e-26
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 2 Region: 686-740
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.22e-23
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 3 Region: 350-407
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.02e-22
Family Classic zinc finger, C2H2 0.009
Further Details:      
 
Domain Number 4 Region: 406-463
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.24e-22
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 5 Region: 630-687
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.64e-22
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 6 Region: 518-575
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.75e-21
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 7 Region: 574-631
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.92e-20
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 8 Region: 295-351
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.84e-19
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 9 Region: 239-295
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000478
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 10 Region: 201-251
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000822
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Weak hits

Sequence:  HGL_H00000409514-2
Domain Number - Region: 1-27
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00157
Family KRAB domain (Kruppel-associated box) 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000409514-2
Sequence length 744
Comment MIR4273 (Homo_sapiens) microRNA 4273
Sequence
MLETYNNLVALGHCSSKPAVIFKLEQGSGPCMVEEAPSQSFPDVQKVNGLIQTNQENQEK
HFWQVVTTSADEKVELGKRFNVNSNHISVLNIKNGNYSGVKPEELNIWQNVEVRAGEEPV
DLHVTGKSFRHLEHLSLHNKFQGIQKYFQYCGQENACNMKAVLTHKKIHVRETSSKFSEY
GKDFDKLAFISQEMTQAREKSIEYNVYHKALYKKAKLFSHEKKHKGQKYYECSDLGEPFI
RKLYVTKHQRTRAGEDPYRCNECDKFFRQKTELNMHQRIHREAKFCEDYECGKNFNQKQN
LSRCLKTHTDEKPYEWNMCEKAFYRKSHLNRHQRTHTGEKLYECKKCWKTFYHKSSLIRH
QRTHTDEKPYDCTKCGKAFSCESDLTIHHRTHTDEKPYECEECRKTFYRKSHLTIHQRTH
TGEKPYECEECRKTFYSKSHLRKHQGIHTGAKSYACEECRKTFNRKSNLTEHKRTHTGEK
PYECNICGKSFNRKSNLSVHQRTHTGEKPYECKECNKTFNHKAALTVHQGTHTGKKPYGC
EECKKTFLHKSSLTVHQRSHTGNKPYACEECRKAFYCRAHLTVHQKTHTGEKPYECQECE
KSFHRKSHLSRHQLTHETEKRFECKQCGKTFYHKASLIIHQRTHTGEKPYECEECRKTFY
SKSHLRVHQSIHTGGKSYACEECRKTFNRKSNLTEHTRTHTGAKPYECNICGKSFNRKSN
LSTHQRIHKGEKPYECKECNNIQS
Download sequence
Identical sequences G5BQ36
HGL_H00000409514-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]