SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000409667 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000409667
Domain Number 1 Region: 523-819,850-897
Classification Level Classification E-value
Superfamily DNase I-like 3.93e-75
Family Inositol polyphosphate 5-phosphatase (IPP5) 0.00000132
Further Details:      
 
Domain Number 2 Region: 888-979
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000112
Family Canonical RBD 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000409667
Sequence length 1574
Comment SYNJ1 (Homo_sapiens) synaptojanin 1
Sequence
RAVSEERRMAFSKGFRIYHKLDPPPFSLIVETRHKEECLMFESGAVAVLSSAEKEAIKGI
YSKVLDAYGLLGVLRLNLGDTMLHYLVLVTGCMSVGKIQESEVFRVTSTEFISLRVDASD
EDRISEVRKVLNSGNFYFAWSASGASLDLSLNAHRSMQEHTTDNRFFWNQSLHLHFKHYG
VNCDDWLLRLMCGGVEIRTIYAAHKQAKACLISRLSCERAGTRFNVRGTNDDGHVANFVE
TEQVVYLDDSVSSFIQIRGSVPLFWEQPGLQVGSHRVRMSRGFEANAPAFDRHFRTLKNL
YGKQIIVNLLGSKEGEHMLSKAFQSHLKASEHAADIHMVNFDYHQMVKGGKAEKLHSVLK
PQVQKFLDYGFFYFDGSEVQRCQSGTVRTNCLDCLDRTNSVQAFLGLEMLAKQLEALTLA
EKPQLVTRFQEVFRSMWSVNGDSISKIYAGTGALEGKAKLKDGARSVTRTIQNNFFDSSK
QEAIDVLLLGNTLNSDLADKARALLTTGSLRVSEQTLQSASSKVLKSMCENFYKYSKPKK
IRVCVGTWNVNGGKQFRSIAFKNQTLTDWLLDAPKLAGIQEFQDKRSKPTDIFAIGFEEM
VELNAGNIVNASTTNQKLWAVELQKTVSRDNKYVLLASEQLVGVCLFVFIRPQHAPFIRD
VAVDTVKTGMGGATGNKGAVAIRMLFHTTSLCFVCSHFAAGQSQVKERNEDFIEIARKLS
FPMGRLLFSHDYVFWCGDFNYRIDLPNEEVKELIRQQNWDSLIAGDQLINQKNAGQIFRG
FLEGKVTFAPTYKYDLFSDDYDTSEKCRTPAWTDRVLWRRRKWPFDRSAEDLDLLNASFQ
DESKILYTWTPGTLLHYGRAELKTSDHRPVVALIDIDIFEVEAEERQNIYKEVITVQGPP
DGTVLVSIKSSLQEDNFFNDALIDELLQQFANFGEVTLIRFVEDKMWVTFLEGSSALSVL
SLNGKELLNRTVTITLKSPDWIKNLEEEMSLEKISVTLPSSTSSTLLGEDAEVAADFDME
GDVDDYSAEVEELLPQHLQPSSSSGLGTSPSSSPRTSPCQSPTIAEAPVPCLPIRPSRAP
SRTPGPPSSQSSPVDTQPAAQPQQKESSQTLEPKRPPPPRPGAPPTRPTPPQRPPPPSGA
RSPAPARKEFGGIGAPPSPGVARREMEAPKSPGTTRKENIGRNQPSSQAGFGGPGPAGPS
TARPTIPPRAGVISAPQSHARASAGRLTPESQSKPPEASKGSTLLPEPLKPQAAFPVQPS
LPSPAPKFQEPLVPTAAPMPQLGPQPTLETPPQPPPRSRSSQGLPSESSPQPQVKTNGVS
SVKQESLLKSDPFEDLSFNLLAVSKAQLSVQTSPVLTPDPERLIQLPPATQSTVNTWSSV
SCMPTMPPIPARSQENTRSSPNPFITSLTSTNPFTDRTAVPGNPFRAQSQESEATSWLSK
EEPITNSPVPSLMPLRQNSSKPSSSLDCFKDSFDLQGQSTVKTSNPKGWVTFEEEEDFGV
KGKSKSFCPNALGNQPNAFDDDWNKGADVSLCVLPSRRPPPPPVPLLPPSASPATDPFTT
LASKASPTQDFTER
Download sequence
Identical sequences G5BE96
HGL_H00000409667

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]