SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000410146 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000410146
Domain Number 1 Region: 180-294,414-560
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.63e-66
Family Phosphate binding protein-like 0.000000000547
Further Details:      
 
Domain Number 2 Region: 55-156
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.12e-17
Family L-arabinose binding protein-like 0.012
Further Details:      
 
Domain Number 3 Region: 310-413
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000152
Family Voltage-gated potassium channels 0.011
Further Details:      
 
Weak hits

Sequence:  HGL_H00000410146
Domain Number - Region: 579-607
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.051
Family Phosphate binding protein-like 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000410146
Sequence length 696
Comment GRIA2 (Homo_sapiens) glutamate receptor, ionotropic, AMPA 2
Sequence
MEADRVLSSGHRTPDHFGVWLGNCLSSVLCKEKPSDQQELEKEKCGGEDTEKNLEDAKWS
YTSALTYDAVQVMTEAFRNLRKQRIEISRRGNAGDCLANPAVPWGQGVEIERALKQVQVE
GLSGNIKFDQNGKRINYTINIMELKTNGPRKIGYWSEVDKMVVTLTELPPGNDTSGLENK
TVVVTTILESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGAR
DADTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPG
VFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEFEDGRETQSSESTNEFGI
FNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPI
ESAEDLSKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTTAEGVARV
RKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLRNAVNLAVLKL
NEQGLLDKLKNKWWYDKGECGSGGGDSKVSPRGRSDGTPVNLAVLKLSEQGVLDKLKNKW
WYDKGECGAKDSGSKEKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSRAEAKRMK
VAKNAQTINPSSSQNSQNFATYKEGYNVYGIESVKI
Download sequence
Identical sequences G5BLW2
HGL_H00000410146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]