SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000410608 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000410608
Domain Number 1 Region: 7-128
Classification Level Classification E-value
Superfamily Hook domain 4.58e-28
Family Hook domain 0.0042
Further Details:      
 
Weak hits

Sequence:  HGL_H00000410608
Domain Number - Region: 678-891
Classification Level Classification E-value
Superfamily Tropomyosin 0.00268
Family Tropomyosin 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000410608
Sequence length 1959
Comment CCDC88A (Homo_sapiens) coiled-coil domain containing 88A
Sequence
MENENFTPLLEQFMTRPLVTWVKTFGPLAAGNGTNLDEYVALVDGVFLNEVMLQINPKLE
NQRVNKKVNNDASLRIHNLSILVRQIKFYYQCQNKEEFIERIQGLDFDTKAAVAAHIQEV
THNQENVFDLQWMEVTDMSQEDIEPLLKNMALHLKRLIDERDEHSETMVELSEERDGLHF
LPHASSSAQSPCSSPGMKRTESRQHLSVELADAKAKIRRLRQELEEKTEQLLDCKQELEQ
MEIELKRLQQENMNLLSDARSARMYRDELDALREKAIRVDKLESEVSRYKERLHDIEFYK
ARVEELKEDNQVLLETKTMLEDQLEGTRARSDKLHELEKENLQLKAKLHDMEMERDMDRK
KIEELMEENMTLEMAQKQSMDESLHLGWELEQISRTSELSEAPQKSLGHEVNELTSSRLL
KLEMENQSLTKTVEELRSTMDSAEGNTSKILKLEKENQSLSKKVEILENEIIQEKQSLQN
CQNLSKDLMKEKAHLEKTIETLRENSERQIKILEQENEHLNQTVSSLRQRSQISAEARVK
DIEKENKILHESIKETSSKLSKIEFEKRQIRKELEHYKEKGERAEELENELHHLEKENEL
LQKKITNLKITCEKIEALEQENSELERENRKFKKTLDSFKNLTFQLESLEKENSQLDEEN
LELRRNVESLKCASMKMAQLQLENKELESEKEQLKKGLELMKASFKKTERLEVSYQGLDT
ENQRLQKALENSNKKIQQLESELQDLEMENQTLQKNLEELKISSKRLEQLEKENKSLEQE
TSQLEKDKKQLEKENKRLRQQAEIKDTTLEENNVKIGNLEKENKTLFKEIGIYKESCVRL
KELEKENKELVKRATIDIKTLVTLREDLVSEKLKTQQMNNDLEKLTHELEKIGLNKERLL
HDEQSTDDSRYKLLESKLESTLKKSLEIKEEKIAALEARLEESTNYNQQLRQELKTVKKN
YEALKQRQDEERMVQSSPPVSGEDNKWERESQETTRELLKVKDRLIEVERNNATLQAEKQ
ALKTQLKQLETQNNNLQAQILALQKQTVSLQEQNTTLQTQNAKLQVENSTLNSQSTSLMN
QNAQLLIQQSSLENENESIIKEREDLKSLYDSLIKDHEKLELLHERQASEYESLISKHGT
LKSAHKNLEAEHKDLEDRYNQLLKQKGQLEDLEKMLKVEQEKMLLENKKHETVAAEYKKL
CGENDRLNHTYSQLLKETEVLQTDHKNLKSLLNNSKLEQTRLEAEFSKLKEQYQQLDITS
TKLNNQCELLSQLKGNLEEENRHLLDQIQTLMLQNRTLLEQNMESKDLFHVEQRQYIDKL
NELRRQKEKLEEKIMDQYKFYDPSPPRRRGNWITLKMRKLIKSKKDINRERQKSLTLTPT
RSDSSEGFLHLPYQDSQDSSSVGSNSLEDGQTLGTKKSSTMNDLVQSMVLAGQWTGSTEN
LEVPDDISTGKRRKELGAMAFSTTAINFSTVNSSAGFRSKQLVNKKDTTSFEDISPQGIS
DDSSTGSRVHASRPASLDSGRTSTSNSNNNASLHEIKAGAVNNQSRSQSHSSGEFSLLHD
YEAWSSSGSSPIQYLKRQTASSPVLQHKMPESLETRTHHRIKTGSPGSEVVTLQQFLEES
NKLTSIQLKSSSQENLLDEVMKSLSVSSDFLGKDKPISCGLTRSVSGKAPEDFCDRRTTK
PEFVRAGSRKTEGIYVISSAGKPTPGTQGKIKFVKETSVSRQSKDSNPYATLPRASNVIS
TAEGTTRRTSIHDFLTKDSRLPVSVDSSQPTAGSNITAASSEYPLHQWSSHMLSGLTQAV
GSHAQNDLAIDMPESLYSQARNSRTERSYFLNQTFSTTKVSYNIFGIACKDSTESFTMPH
SSQPFLSLNTELVSNISGLPLRLTIRETNQASASLEKTSHFTEGNEQFSDSQNPSNSSPQ
ASIDSSNLITPTCLYPDDTEHTLLVSEDNQTIWYEYGCV
Download sequence
Identical sequences G5B8W7
HGL_H00000410608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]