SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000410703 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000410703
Domain Number 1 Region: 33-94
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.62e-27
Family KRAB domain (Kruppel-associated box) 0.00085
Further Details:      
 
Domain Number 2 Region: 296-353
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.81e-25
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 3 Region: 184-237
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.7e-23
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 4 Region: 240-297
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.66e-21
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 5 Region: 338-390
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.64e-20
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 6 Region: 146-198
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.44e-19
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000410703
Sequence length 398
Comment ZNF558 (Homo_sapiens) zinc finger protein 558
Sequence
LISSSPAQSCIYPASPQKGRTGKERLVSEFLTCWLQDLVTFEDVAVDFTQEEWALLDTSQ
RSLYREVMLENCRNLASLGCHVGKPSLISQLEQEDKVIIEERRNLPRTCPDLETVLKAKW
LTPKKDAFRREQVKGVKTERSRHGVKINECNQCFKVFSTKSNLTQHKRIHTGEKPYDCNQ
CGKSFSSRSYLTIHRRIHNGEKPYECNHCGKAFSDPSSLRLHVRIHTGEKPYECNQCFHV
FRTSCNLKSHKRIHTGENHHECNQCGKAFSTRSSLTGHNSIHTGEKPYECHDCGKAFRKS
SYLTQHVRTHTGEKPYECNECGKSFSSSFSLTVHKRIHTGEKPYECSDCGKAFNNLSAVK
KHLRTHTGEKPYECNHCGKSFTSNSYLSVHKRIHNRWI
Download sequence
Identical sequences G5AXQ3
HGL_H00000410703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]