SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000410890-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000410890-2
Domain Number 1 Region: 258-319
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.14e-21
Family KRAB domain (Kruppel-associated box) 0.002
Further Details:      
 
Weak hits

Sequence:  HGL_H00000410890-2
Domain Number - Region: 168-241
Classification Level Classification E-value
Superfamily Tropomyosin 0.00235
Family Tropomyosin 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000410890-2
Sequence length 353
Comment ZNF783 (Homo_sapiens) zinc finger family member 783
Sequence
MGPREPAPAPRVPPLRSPRRAVLRPAGGAVRGLRRRGPQLFRKGQRGTWLVSRDAARGLR
AAPKPGSASPTPAQAPGRRARSPERTRPLQPKRSPARVQRRKKGWGFCRFLALVLVELGS
LPVAVQVPERDKPMGDQHPSTPCPSPLPATKKSSYLYSTEITLWTVVAAIQAVEQKVDSC
LARLLALEGRAGTAEKKLADCEKTAVELGNQLEGKWAVLGTLLQEYGLLQQRLENMENLL
RNRNFWILRLPPGSKGEVPKVPVTFSDVAVYFSEQEWGELEDWQKELYKHVMRGNYETLV
SLDYAISKPDILAQMERGEEPCPCPTAPWSQDKGSREAATHPRTQGECGRLQE
Download sequence
Identical sequences G5AMM1
HGL_H00000410890-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]