SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000410913 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000410913
Domain Number 1 Region: 1-50
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.55e-18
Family KRAB domain (Kruppel-associated box) 0.00065
Further Details:      
 
Domain Number 2 Region: 58-107
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000217
Family Classic zinc finger, C2H2 0.0092
Further Details:      
 
Domain Number 3 Region: 97-128
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000311
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000410913
Sequence length 128
Comment ZNF442 (Homo_sapiens) zinc finger protein 442
Sequence
VIFEDVAVNFTMEEWALLDPPQNKLYRDVMWETFQNVTAIGRNIDDQQIEDEYKNYRKNL
RKLTLGEKPYLCKQCGKAFRTHSNCHIHERTHTGEKPCICKQCGTAFSIQSHCRRYEQTH
TGEKPYAC
Download sequence
Identical sequences G5BIS9
HGL_H00000410913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]