SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000411012-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000411012-1
Domain Number 1 Region: 210-438
Classification Level Classification E-value
Superfamily BEACH domain 4.58e-87
Family BEACH domain 0.000000344
Further Details:      
 
Domain Number 2 Region: 506-669
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.83e-30
Family WD40-repeat 0.00092
Further Details:      
 
Domain Number 3 Region: 101-194
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000201
Family PreBEACH PH-like domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000411012-1
Sequence length 670
Comment NSMAF (Homo_sapiens) neutral sphingomyelinase (N-SMase) activation associated factor
Sequence
MANRHSAKAKCAGISLIFSQVYFIKEHNIVAPYKKERGKMEYVFELDVSGKVEDVVETLL
QLHRASCLDKLGDQTAMITAILQSRLARTSFDKNRFQSVSEKLHIECKAEMVTPLVTNPG
HVCITDTNLYFQPHSGYPKPVVQITLQDVCCIYKRRHGLMPLDLEVFCTENDLCSDIYLK
FYEPQDRDDLYFYIATYPEHHVVEHTAESYMLQWHCNDLSQYPVFPWIISDYYSPDLDLS
NPGNFRDLSKPVGALNKERLERLLTRYQEMPEPKFMYGSHYSSSGYVLFYLVRIAREYML
CLQNGRFDNADRMFNSIAETWKNCLDGVTDFKGGQMVNDVELPLWASSPEDFLQKSKGAL
ESTYVSQHLHEWIDLVFGYKQNGNDAVGAHNVFHPLTYEGGVDLNSIEDPVEKVAMLTQI
LEFGQTPKQLFVTPHPQKITSKFKNMSQTSSYNASIADSPVSPDEESFEDLTEERKTLAW
NNITKLQLLKVWSGVPAEMPGTERHQFDLLAELEHDVSVATINLNAASTLLASGTKEGIV
TIWDLTTATLLHQIPCHSGAVCATAFSPDSSHILSTGVDGCLNVINVQTGMHIFSMASDQ
PQRCFIWDRNSVLSGSESGELLFWDLLGAKIREGIQGHSGAVTCIWMNEQCSSAITGGED
RQIMFWKLQY
Download sequence
Identical sequences G5B3F3
HGL_H00000411012-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]