SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000411012-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000411012-2
Domain Number 1 Region: 228-476
Classification Level Classification E-value
Superfamily BEACH domain 1.31e-86
Family BEACH domain 0.00000058
Further Details:      
 
Domain Number 2 Region: 516-753
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.08e-39
Family WD40-repeat 0.00075
Further Details:      
 
Domain Number 3 Region: 137-230
Classification Level Classification E-value
Superfamily PH domain-like 4.51e-17
Family PreBEACH PH-like domain 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000411012-2
Sequence length 754
Comment NSMAF (Homo_sapiens) neutral sphingomyelinase (N-SMase) activation associated factor
Sequence
MEEEVEEEEKEEEEKEFSLLLLNLEEYYFEQHAAHHIQHRGSNDERKIRGSLKICSKSVI
FEPDAISQPIIKVYFIKEHNIVAPYKIERGKMEYVFELDVSGKVEDVVETLLQITAILQS
RLARTSFDKNRFQSVSEKLHMECKAEMVTPLVTNPGHVCITDTNLYFQPLNGYPKPVVQI
TLQDVCRIYKRRHGLMPLGLEIFCTENDLCSDIYLKFYEPQDRDDLYFYIATYLEHRAVE
HSAESYMLQWQRGHLSNYQYLLHLNNLADRSCSDLSQYPVFPWIISDYSSPDLDLSNPGT
FRDLSKPVGALNKERLERLLTRYQEMPEPKFMYGSHYSSPGYVLFYLVRIAPEYMLCLQN
GRFDNADRMFNSIAETWKNCLDGATDFKELIPEFYGDDVSFLVNSLKLNLGKRQGGQMVD
DVELPLWASIFHPLTYEGGVDLNSIEDPDEKVAMLTQILEFGQTPKQLFVTPHPQKITSK
FKSMSQTSSYNASIAESPGEESFEDLTEESKTLAWNNITKLKLYEQYKIHKEAVTGIAVS
CDGSSVFTTSQDSTLKMFSKESKMLQRSISFSNMVWSGVPAEMSGTKRQQFDLLAELEHD
VSVDTINLNAASTLLASGTKEGMVTIWDLTTATLLHQIPCHSGAVCATAFSPDSRHILST
GVDGCLNVIDVQTGMHISSMASDQPQRCFIWDGNSVLSGSESGELLVWDLLGAKISERIQ
GHSGAVTCIWMNEQCSSVITGGEDRQIMFWKLQY
Download sequence
Identical sequences G5B708
HGL_H00000411012-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]