SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000411015 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000411015
Domain Number 1 Region: 283-477
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.9e-54
Family BCR-homology GTPase activation domain (BH-domain) 0.000000012
Further Details:      
 
Domain Number 2 Region: 110-250
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 9.55e-22
Family CRAL/TRIO domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000411015
Sequence length 485
Comment ARHGAP1 (Homo_sapiens) Rho GTPase activating protein 1
Sequence
MGAALLDQKKATAVGWRWCERSQYGQEGGTTVITLEKEVFGGSAVDSAMDPLSELQDDLT
LDDPSLNQLKLASIDEKNWPSDDMPDFPKSDDSKSSSPEPVTHLKWDDPYYDIARHQIVE
VAGDDKYGRKIIVFSACRMPPSHQLDHSKLLGYLKHTLDQYVESDYTLLYLHHGLTSENK
PSLSWLRDAYREFDRKYKKNIKALYIVHPTVFVKTLLILFRPLISLKFGRKILYANYLSE
LSEHLKLEQLGIPRQVLKYDDFLKSTQKSPATTPKPMPPRPPLPNQQFGVSLQHLQEKSL
GQEPIPVVLRDTVAYLQAHALTTEGIFRRSANTQVVREVQHKYNMGLAVDFNQYNELHLP
AVILKTFLRELPEPLLTFDLYPHVVGFLNIDESQRVEATKQVLQTLPEENYQVLRFLTAF
LVQVSAHCDQNKMSNTNLAVVFGPNLLWAKDAAITLKAINPINTFTKFLLDHQGELFPSP
DPRGL
Download sequence
Identical sequences G5ATC2
HGL_H00000411015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]