SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000411051 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000411051
Domain Number 1 Region: 267-324
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.49e-24
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 2 Region: 211-268
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.24e-24
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 3 Region: 323-380
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.07e-21
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 4 Region: 1-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.1e-21
Family KRAB domain (Kruppel-associated box) 0.0017
Further Details:      
 
Domain Number 5 Region: 365-417
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.66e-21
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 6 Region: 176-225
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-17
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000411051
Sequence length 427
Comment ZNF2 (Homo_sapiens) zinc finger protein 2
Sequence
QESVTFEDVAVIFTDEEWRHLVPVQRALYQAVMLENYESIVSLGLPVPPPDVIFWLKRGD
EPWREGPQGSEERECPQSISLENKLHSFLFVPDLETKLETQDASKEENPEETLRQSLRRQ
SPLCPKLKVQAPEGGLRAERERPAVGTCKKAPSQDKSLCRGLAPSRKILPKERDQECSDC
GKTFFDHSSLIRHQRTHTGEKPYDCRECGKAFSHRSSLSRHLMSHTGESPYECGACGKAF
FDRSSLTVHQRIHTGEKPFKCSECGKAFFDRSSLTRHQRIHTGESPYECHQCGKAFSQKS
ILTRHLLIHTGRKPYECSECGKAFYGVSSLNRHQKAHAGEPRYQCNECSKAFFDRSSLTQ
HQKIHTGDKPYECTECGKAFSQRCRLTRHQRVHTGEKPFECSVCGKVFSSKSSVIQHQRR
YAKQVMD
Download sequence
Identical sequences G5APT3
HGL_H00000411051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]