SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000411147-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000411147-2
Domain Number 1 Region: 25-304
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.55e-83
Family Ankyrin repeat 0.00000000441
Further Details:      
 
Domain Number 2 Region: 371-591
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.24e-31
Family Protein kinases, catalytic subunit 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000411147-2
Sequence length 689
Comment RNASEL (Homo_sapiens) ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent)
Sequence
METKGPNNPQEGPMPSNFRRATMENGHSLINAVKNKDVNQIEQLLKIGASVNFQEEEGGW
TPLHNAVQGGSKDIVELLLDHGADPHQRKKNGATSFIIAGIEGNVELLRLFLSKGADVNE
YDSNGFTAFMEAAEQGNAEALKFLYESGANVNLHRETKADQKVLGKGGGTALMDAAKKGH
IDVLRILLEKMRAEVNACDNMGRSALIHGIQSSPDEKVEDITRLLLDHGADICMRGEREK
TPLILAVEKKHVGLVQMLLEQKHIDIDAKDDKGRTALLVAVQLNLKVIVELLCKKGANTD
CGDLVWIAKRKHYNNDLAKLLCSYGAQDYFQPPTKDWKPLSSRWGKDLKKLYRMYHRKTG
KLKIFKGEDYKIAKTSKGDIYLGLYEEREVAVKVFREGSEHAVREMDCLQHIQGHSNLLT
FYGSESEGAWLYVCVALCEESLEELLDKRRGDAMEDEEDTFARNVLASIFKAVQELHLHE
YIHQDLQPGNILIDSKKAVLLADFDQSIKWTGDPQEIKSDLEALGRLALYVVKKGEIPFE
RLKAQSIEQVLQLSPDEETKDLIHHLLCPGENMRDYLNNLLSHPFFWTWENRYRTLRNVG
NENDIKVRKSDSEILKLLQPGSSECSRSFDKWKDKCWDTEFSVRLPSGQRPLCSCPPSSE
NHALGDVGQGTALTGFSLHSATILHTLDS
Download sequence
Identical sequences G5BE40
HGL_H00000411147-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]