SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000411545 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000411545
Domain Number 1 Region: 73-392
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.33e-70
Family Motor proteins 0.0000453
Further Details:      
 
Weak hits

Sequence:  HGL_H00000411545
Domain Number - Region: 1113-1324
Classification Level Classification E-value
Superfamily Tropomyosin 0.00019
Family Tropomyosin 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000411545
Sequence length 1607
Comment KIF20B (Homo_sapiens) kinesin family member 20B
Sequence
MLKIKTSAPLKTTAAIPSNSKDLSTDDTSSHQENHLQQTFPGKSTAYNLTFQFSFCAISN
NSQAESLESKDYLQVCLRIRPFTQAEKEHESEGCVHVVDSQTVLLKDPQITVGRLSEKSS
GQMAQKFTFSKVAMHNESYDNIHGSLTNSLNILEFEESMKDCEQACLNMDNNIKFSVWVS
FFEIYNECIYDLFVPVSSKFQKRKILRLSQDVKGYSFIKDLQWVQVSDSKEAYRLLKLGI
KHQSVAFTKLNNASSRSHSIFTIRILQIEDSEISCVLGVSELSLCDLAGSERSMKTQNEG
ERLRETGNINTSLLTLGKCINVLKNSEKSKFQQHVPFRESKLTHYFQSFFNGKGKICMIV
NISQCLFAYDETLNVLKFSAIAQKVCVPDNLNSSQEKSLGSVKSSQDVSDNNLDNKILNA
KRTTISWENSLEDLVEDEDLAEDLEKPEENQENQSVETELIDEDLDKTLEEDKAFISHEE
NRKLLDLIEDLKTRLINEKKEKLTLEFKIREEVTQEFTQYWAQREADFKETLLQEREILE
ENAECRLAIFKDLFDKCNTQDEPTNGICATEVDNEDPHNYVGFEDIIGSLQHDVTDIKKQ
AEIVHSYIASLADPQEAIACLQLIKTELAKTKEELIKTKEELKKRENESLVQELKMSNKG
KAVTSSLMNSKSTCNETAEIPKGSKTKTYLERKRVNENELQRDEPPAKKGSVLVNSFITK
DQKESEEIQQTISEDEDNIRVLQEKNRELKTLVLIVESELKNEKEEKEKLNEQIVCLQQQ
LSCSEEKSLTLSIEVQQIQANYDSIIALLSVQKNKNQEQEEKIMKLSEEIEVATRNITRN
VSQIKLIQTKMDELRSLDSVSQISNIDLLKLSTQSDGLQEENLPDTQLHLSSNNFLVTIW
EECKEIVKASSKKSHKIQELQQQIEKLQAEMKGYRDENYVLKVKHRELENQDDLQKEREN
LIQQLKEELQEKNVSLNVQVQLVVEGQKALSELTQDVICYKAKVKELETILETQKDECSH
LTKLEQDILVKESVILKLEENLKEFQANLSESIKNTKDLSEKEVKLKEEITWLTSNLQDL
KHSLQLKEEEKEANTQETEKLKEELCASSALTQSLKADLQRKEEDYAELKEKLSDAKKQI
EQVQKEVSVMRDEEKLLRTKINELEKKKNQCSQEIDMKQRTIQQLKEQLSNQKVQEAVQQ
YERVCKDLNVKEKMIKDMRMTLEEQEQTQTEQDQVLEAKLEEAEWLATELERWKEKCKDL
ETKNSCKSNRKFEDDTDILHRKLSKLQDELQEVLTAQLAEKNSDLQKWREERDQLVAALE
IQLKTLISSNIQKDNEIEQLKKSTSEDSETEKQSIVIKPRYTSSTDPAMVENEPQSTSFE
ISRSVVEDGSVVLDSCEVSTENEQSTRFPKPELEIQFTPLQPNKMAVKHPGCTTPVTVKI
SKARKRKSSEMEEDLVKCENKKNATPRANSKFPISETGHSSDKKVSAHLSSKKTYSLRSQ
APTISANLASKKKEGTLQKFGDFLQHSPTILQSKAKKIIETMSPSKHSNLEASKENVSQP
KRAKRKLYTNEISSPIDISGQVILMDQKVKESDHQILKRRLRSRVAK
Download sequence
Identical sequences G5B0Z5
HGL_H00000411545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]