SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000411716 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000411716
Domain Number 1 Region: 787-994
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.43e-49
Family BCR-homology GTPase activation domain (BH-domain) 0.0000708
Further Details:      
 
Domain Number 2 Region: 295-577
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 5.13e-48
Family FCH domain 0.0092
Further Details:      
 
Domain Number 3 Region: 715-767
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000628
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000411716
Sequence length 1144
Comment HMHA1 (Homo_sapiens) histocompatibility (minor) HA-1
Sequence
MSGHRMVLRGLLGWVCGWTKAWRAGFGTGSCGLPGLCPRQAPHPPKELPRKDGLDAVFPG
PGLEPPVTSSGVKNTATLKRPTSLSRHASAAGFPLSGAGSWTLGRGYRSPLTAASPAEVP
TEGPGTEATDDISNLLADVARFAEGLEKLKECVLHDDLLEARRPLAHECLGEALRVMRQV
ISKYPLLNTVETLTAAGTLIAKVKAFHYECNNESDKREFEKALETIAVSFSSTVSEFLMG
EVDSSTLLAVPPGDPSQSMESLYQGSEGSPPSAEDCEEGCPPPEEVDMLLQRCEGGVDAA
LQYAKNMAKYMKDLIGYLEKRTALEMELAKGLQKLIHGARQNITHEPHMPLLSIYSLALE
QDLEFGHGMVQAVGTLQTQTFMQPLTLRRLEHERRRKEIKESWHRAQRKLQEAEANLRKA
KQSYVQRCEDHDKARLQVAKAEDEQAATSPGAGSTASKTLDKRRRLEEEAKNKADEAMAT
YRTCVADAKTQKQELEDTKVTALRQIQEVIRQSDQTIKSATISYYQMMHMQTAPLPVHFQ
MLCESSKLYDPGQQYASHVRQLQRGEEPDVRYDFEPHVSANAWSPVTRARKNSFNIGDTL
GTEATSSSPSEEGGPSEGTSAKDHRGGRGHQVHKSWPISVSDSDGSLAPSDGSGDFKKFQ
RMSSSGTVSSSEELVDQEGGAGTAEFEQDDINSMAPQLPVAVPSGPFRHVGLSKAARTHR
LRKLRTPAKCRECNSYVYFQGAECEECCLACHKKCLETLAIQCGHKKLQGRLQLFGQDFS
RATWGTPDGIPFIVKRCLCEIERRALRTKGIYRVNGVKTRVEKLCQAFETSQELVELSQA
SPHDISNVLKLYLRQLPEPLISFRLYHELVGLAKDSLKAEAEAKAASRGARQDGSESEAA
AMAMAGRLRELLRDLPPENQATLRYLLRHLRRIVEVEQDNKMTPGNLGIVFGPTLLRPRP
TEATVSLSSLVDYPHQARVIETLIVHYSLVFEDEPEEGLRAQDEASSQRSEVVVPVPYLE
AREAATYALQEEDRGRESRVASNDSDSELEEASDSLSLSDASALHRLSFLEKQEGEASPE
EGPRSRSGSEEQLGNEDEEGPAQQLSTYNTNQSNNVALARLLPMRLRTKCISGASCGHRR
PEFV
Download sequence
Identical sequences G5C5Y5
XP_004866038.2.39548 HGL_H00000411716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]