SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000412292 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000412292
Domain Number 1 Region: 12-155
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.09e-24
Family DEP domain 0.03
Further Details:      
 
Domain Number 2 Region: 227-299,588-683
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.0000000000000534
Family BCR-homology GTPase activation domain (BH-domain) 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000412292
Sequence length 823
Comment DEPDC1 (Homo_sapiens) DEP domain containing 1
Sequence
MESRGAPPGPYRATKLWNEVTTSFRTGMPLRKHRQHFKKYGNCFTAGEAVDWLYDLLRNN
SNFGPEVTRQQTVQLLRKFLKNHVIEDIKGRWGSENLDDNNQLFRFPAISPPKTLPRRHP
ELRKNSIDSCSKDKENVFKLRNLSRRTPKKHGLHFSQETTEKVNHEIREDQENSEDYREI
SQEDVEEVWRYVILIYLQTILCVPSLEELINPNQVIPQYVMYNMANTSRRGVVILQDKSD
DLPHWVLSAMKCLANWPRSNDMSNPTYVGFERDVFRTIADYFLDLPEPLLTYEYYELFVN
ILVVCGYITVSDRPSGIHKIQDDPQSSKILHLTNLNSFKSTECLLLSLLHRDKNKEESDS
TERQQISDQGFQEGCAKKMQLVDLRRRRVSADDVMGGSCHNLIGLSSLHVLSNNIKPRCF
SLEGIVDMPGYSSKNVSSTFHRSVLNTEQQSSEHFLESKTRQESLLNLHSDGSIHKPLCG
GGFKRTSTVTVEDQEESSHGDCKPKQLCRSQSLLLRSSTRRNSYVNTPVAEIIMKPNFGQ
GSTSVQRAMESELGEDSITINKRLCKSTIELSKNSSFPPASAMLTGTQSLLQPHLERVAI
NALQLCCLLLPPRNRRKLQLLMRMISRMSQNVDMPKLHDAMGTRALMIHTFSRCVLCCAE
EVDLDELLAARLVSFLMDHHQEILQVPSYLQTAVEKQLDYLKRGHVAFHCLLCSLQIKSP
GDGLIVPLPAYSYCKQISAQEFDEQKVSTSQAAVAELLENIIKNKGLTLKEKRRKLKQFQ
KEYPLIYQKRFPTTESEAALFGDKPTIKQPMLILRKPKFRSLR
Download sequence
Identical sequences G5BSQ7
HGL_H00000412292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]