SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000412999-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000412999-2
Domain Number 1 Region: 144-201
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.73e-24
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 2 Region: 312-369
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.24e-23
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 3 Region: 257-313
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.74e-22
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 4 Region: 200-257
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.89e-21
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 5 Region: 354-406
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.78e-20
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 6 Region: 76-136
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.9e-17
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 7 Region: 1-47
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000000000222
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000412999-2
Sequence length 412
Comment ZNF805 (Homo_sapiens) zinc finger protein 805
Sequence
VTFEDVVIRFNQEEWDQLDLSKRTLYWEVMLETCGLLIAVADSVCSRSVQEHISPDPATC
ICDSNMPAADPSIREGENSYKCKECGKVFKNERLLIQHKWIHTGVKRYECTECGKTFRKS
THLLQHHIVHTRERPYMCLECDKAFSRKSYLTQHQRTHSGEKPYKCSECGQAFAHRSTFV
LHNRMHTGEKPFVCKECGKAFRDRRAFNRHNIFHTGEKPYQCSECGKAFNQRSYLTWHQQ
THKGVKPFQCNECGRGFCEIAGLIHHYVIHTGEKPYKCVECGKAFLREPHLKQHQRIHTG
EKPYVCSECGKAFAHYSTLTLHRRAHTGEKPFECKECGKAFTNRKDLIRHVSIHTGEKPY
ECMECGKAFNRRSHLIRHHRIHNEEKPYKCMECGKTFSRSTNLIQHSNIHTG
Download sequence
Identical sequences G5C8H8
HGL_H00000412999-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]