SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000413254-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000413254-1
Domain Number 1 Region: 524-659
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 8.11e-40
Family Synaptotagmin-like (S variant) 0.00000034
Further Details:      
 
Domain Number 2 Region: 356-489
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.42e-36
Family Synaptotagmin-like (S variant) 0.0032
Further Details:      
 
Domain Number 3 Region: 45-164
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.66e-33
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.000000867
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000413254-1
Sequence length 668
Comment RPH3A (Homo_sapiens) rabphilin 3A homolog (mouse)
Sequence
MTDTVVSSSSNRWMYPNQRPLQSRVQAGWSVHPSGQTDRQRKQEELTDEEKEIINRVIAR
AEKMEEMEQERIGRLVDRLENMRKNVAGDGVNRCILCGEQLGMLGSACVVCEDCKKNVCT
KCGVETSNNRLHPVWLCKICIEQREVWKRSGAWFFKGFPKQVLPQPMPIKKTKPQQPITK
PAGLEQPTREPKHTVPAPAQGDTEDRRAPGQKPGPDPASTPGRGSHGPPVRRASEARMSS
ATRDSESWDHGHSGSAGDASRSPAGLRRTNSVQASRPSPASGPSPAPPQPGPPEVAMGGP
GYLGPTTPLREERTGGAREEQAAPPLGPYSQASAAAAPQPATSARPLPPEEEEEANSYDS
DEATTLGALEFSLLYNQDNSSLQCTIIKAKGLKPMDSNGLADPYVKLHLLPGASKSNKLR
TKTLRNTRNPIWNETLVYHGITDEDMQRKTLRISVCDEDKFGHNEFIGETRFSLKKLKPN
QRKNFNICLERVIPMKRAGTTGSARGMALYEEEQVERIGDIEERGKILVSLMYSTQQGGL
IVGIIRCVHLAAMDANGYSDPFVKLWLKPDMGKKAKHKTQIKKKTLNPEFNEEFFYDIKH
SDLAKKSLDISVWDYDIGKSNDYIGGCQLGISAKGERLKHWYECLKNKDKKIERWHQLQN
ENHVSSDD
Download sequence
Identical sequences G5AKV8
HGL_H00000413254-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]