SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000413254-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000413254-2
Domain Number 1 Region: 35-168
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.56e-36
Family Synaptotagmin-like (S variant) 0.0058
Further Details:      
 
Domain Number 2 Region: 179-228,267-351
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.49e-33
Family Synaptotagmin-like (S variant) 0.00000445
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000413254-2
Sequence length 362
Comment RPH3A (Homo_sapiens) rabphilin 3A homolog (mouse)
Sequence
MCQPEGQVNEPASQATQGLQLLKAPSLPCHTVLMTFPALGTLDFSLLYDQENNALHCTIS
KAKGLKPMDHNGLADPYVKLHLLPGASKANKLRTKTLRNTLNPTWNETLTYYGITDEDMI
RKTLRISVCDEDKFRHNEFIGETRVPLKKLKPNHTKTFSICLEKQLPVDKTEDKSLEERG
RILISLKYSSQKQGLLVGIVRCAHLAAMDANGYSDPYVKTQARPCTKLGHGQLVWELQGP
CSHILHPSPSQVHLAFQRYLKPDVDKKSKHKTAVKKKTLNPEFNEEFCYEIKHGDLAKKT
LEVTVWDYDIGKSNDFIGGVVLGINAKGERLKHWFDCLKNKDKRIERWHTLTNELPGAAL
SD
Download sequence
Identical sequences G5BVL2
HGL_H00000413254-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]