SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000413303-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000413303-1
Domain Number 1 Region: 137-232
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.15e-22
Family Canonical RBD 0.00038
Further Details:      
 
Domain Number 2 Region: 51-137
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.13e-16
Family Canonical RBD 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000413303-1
Sequence length 402
Comment HNRNPR (Homo_sapiens) heterogeneous nuclear ribonucleoprotein R
Sequence
MHCLCGYRKPRVCVYHTCGKEAAQEAVKLCDSYEICPGKHLGVCISVANNRLFVGSIPKN
KTKENILEEFSKVTEGLVDVILYHQPDDKKKNRGFRFLEYEDHKSAAQARRRLMSGKVKV
WGNVVTVEWADPVEEPDPEVMAKVKVLFVRNLVTRVTEEILEKSFSEFGKLERVKKLKDY
AFVHFEDRGAAVKAMDEMNGKEIEGEEIEIVLAKPPDKKRKERQAARQASRSTACEDYYY
YPPPRMPPPIRGRGRGGGRGGYGYPPDYYGYEDYYDDHYGYDYHDCHGGYEDPYHGYDDG
YAGRGRGGGRGGGGRGGPAQQQRGRGSRGARGNRGGNVGGKRKADGYNQPDSKRRQTNNQ
QNWGSQPIAQQSLQQGGDYSGNYGYNNDNQEFYQDTYGQQWK
Download sequence
Identical sequences G5AWC2
HGL_H00000413303-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]