SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000413303-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000413303-2
Domain Number 1 Region: 38-90
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000271
Family Canonical RBD 0.0093
Further Details:      
 
Domain Number 2 Region: 1-35
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000394
Family Canonical RBD 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000413303-2
Sequence length 163
Comment HNRNPR (Homo_sapiens) heterogeneous nuclear ribonucleoprotein R
Sequence
MMDPLSGQNGGYAFITFCGKEAAQEAVKLCDSYEIHPDRRAAVKAMDEMNGKEIEGEEIE
IVIAKPPDKKRKDRQAARQTSRNTAYEDYYYHHPPHMPPPIRGRGRGGGRGGYGYHPDYY
GYEDYYDNYYGYDYHDYCGGYEDPYYGYDDGYAVRGRGGGRGG
Download sequence
Identical sequences G5BC49
HGL_H00000413303-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]