SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000413406 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  HGL_H00000413406
Domain Number - Region: 100-291
Classification Level Classification E-value
Superfamily Tropomyosin 0.0719
Family Tropomyosin 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000413406
Sequence length 498
Comment CCDC68 (Homo_sapiens) coiled-coil domain containing 68
Sequence
MTAVTVTAEFPSRGSREDNSALYESTSAHIVEETEYVRKIRTTLEKIRNQMFKDEVGQNS
TNHKLDAKHCGNVQNGPDSEMNSSCCSLDLLLNEMRGKDLQLLEMNKENEVLKIKLAASR
EAGAAALRNVAQRLFENYQTQSEDLRRKHEDSTHLLQVNKLEKEQKLKQHVENLNQVAEK
LEEKHNQIIELENLVQRMEKEKRTLLERKLSLENKLLQLKSNAPYAKRCQDVQMEISILQ
EQISHLQFVIHSQHQNLRSIIQEMEGLKNTLKEQDKRIENLKEKVNILEAQSTPSETKDA
LFQYGFSVKSLVKAPTRSVPHKPGGLASCLLPLFPYMFLSQPEMSSSLLFLYPHPSWHPS
FTTGLAYFQKSVATILLFSVLKLDVMLSNFPSCLAVAAYAVCVPASQKCSEAWVKVGTPL
SICGTSSSTILSVPPLCLCQMAHPQLPGPSCTFYFTPQGIVFLLGIHLLVLAFPVEDRDA
LTFTGNQYHLLELVSSPA
Download sequence
Identical sequences G5BEJ7
HGL_H00000413406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]