SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000413411-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000413411-2
Domain Number 1 Region: 350-407
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.02e-26
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 2 Region: 294-351
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.88e-23
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 3 Region: 441-487
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.53e-20
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 4 Region: 257-308
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.4e-19
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 5 Region: 476-528
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.02e-17
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 6 Region: 396-444
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.74e-16
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 
Domain Number 7 Region: 1-32
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000157
Family KRAB domain (Kruppel-associated box) 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000413411-2
Sequence length 529
Comment ZNF724P (Homo_sapiens) zinc finger protein 724, pseudogene
Sequence
MYRDVMLETYRNLVSLGFAGSTPNLITFLEQSKEPCNVKRQETLAVYPAVSSHFAQGISS
KQGRKCSFQNMTEERHSICGHDNLYFKKEWENMGEYEDQNASYNGCNKFVITKESKNFIV
SRDKHIVFQKKTEFVPATFKDPHVFVGEYSHQILKHAFSLKRNLENLRMRPVHALVHHLK
SFKCNIGLNFEPFILVDNKSESEEQIPNCNQFSFFMKGSLVCNQQICLPNTKVNSVHEYG
MLFTHPLLPNQNLDIGIYSCKECGKAFKSSSNLTRHEKTHSGEKPYKCNECGKAFNNCSY
LSQHQRIHNGEKLYRCEECGKAFNWFSRLTIHQRIHTGERPYKCEECGKAFNCRSHLTRH
QRIHTGEKPYKCEECGKFFTHGSNLTQHQRIHTGEKPFKCNECGKAFNKRSNLSLHQRVH
TRENTYKCEECGRTFGTWSPLRIHNGEKLYKCKECGKAFSYSSVLSRHQRIHTGEKPYKC
KECGKDFRHDISLTRHHRIHSGEKPYKCKECGKAFIRCSHLTQHKRIHT
Download sequence
Identical sequences G5BWQ5
HGL_H00000413411-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]