SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000413532 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000413532
Domain Number 1 Region: 905-1032
Classification Level Classification E-value
Superfamily Mss4-like 5.93e-53
Family Translationally controlled tumor protein TCTP (histamine-releasing factor) 0.000000342
Further Details:      
 
Domain Number 2 Region: 438-528
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.39e-19
Family Canonical RBD 0.00000482
Further Details:      
 
Domain Number 3 Region: 347-431
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.26e-16
Family Canonical RBD 0.00000943
Further Details:      
 
Weak hits

Sequence:  HGL_H00000413532
Domain Number - Region: 246-278
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000306
Family Classic zinc finger, C2H2 0.041
Further Details:      
 
Domain Number - Region: 804-840
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00833
Family HkH motif-containing C2H2 finger 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000413532
Sequence length 1033
Comment MATR3 (Homo_sapiens) small nucleolar RNA host gene 4 (non-protein coding)
Sequence
MNQGTARLASLMNLGMSSSLNQQGAHSALSSASTSSHNLQSIFNIGSRGPLPLSSQHRGD
ADQASNILASFGLSARDLDELSRYPEDKITPENLPQILLQLKRRRTEEGPTLSYGRDGRS
ATREPPYRVPRDDWEEKRHFRRDSFDDRGPSLNPVLDYDHGSRSQESGYYDRMDYEDDRL
RDGERCRDDSFFGETSHNYHKFDSEYERMGRGPGPLQERSLFEKKRGAPPSSNIEDFHGL
LPKGYPHLCSICDLPVHSNKEWSQHINGASHSRRCQLLLEIYPEWNPDNDTGHTMGDPFM
LQQSTNPAPGILGPPPPSFHLGGPAVGPRGNLGAGNGNLQGPRHMQKGRVETSRVVHIMD
FQRGKNLRYQLLQLVEPFGVISNHLILNKINEAFIEMATTEDAQAAVDYYTTTPALVFGK
PVRVHLSQKYKRIKKPEGKPDQKFDQKQELGRVIHLSNLPHSGYSDSAVLKLAEPYGKIK
NYILMRMKSQAFIEMETREDAMAMVDHCLKKALWFQGRCVKVDLSEKYKKLVLRIPNRGI
DLLKKDKSRKRSYSPDGKESPSDKKSKTDGSQKTESTTEGKEQEEKSGEDAEKDTKDDQT
EQEPNMLLESEDELLVDEEEAAALLESGSSVGDETDLANLGDVASDGKKEPSDKAVKKDT
SASAAAKKKLKKRRFPGSMEGFVTLDEVGDEEDSELQKLRKSGMAFKKSGDKNDDDLVEI
KVDKIEELDQDNEAALENGIKNEENTEPGAESAENADDPNKDTSENADGQSDENKEDYTI
PDEYRIGPYQPNVPVGIDYVIPKTGFYCKLCSLFYTNEEVAKNTHCSSLPHYQKLKWSRR
AALTGQGGGAADGSEVTSGLVFVWTGEGRRRAKRTSSGGAALRVEIRGGRQDSLAAVPAA
VHWTHDSLIGGNPSAEGPEGEGTGSTVVTGVDIVRNHHLQETSFTKEAYKKYIKDYMKSV
EGKLEEQIPERVKPFMTGAAEQIKHILANFKNYQFFIGANMNPDGMVALLDYREDGVTPF
MIFFKDGLEMEKS
Download sequence
Identical sequences G5AZ68
HGL_H00000413532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]