SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000413625 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000413625
Domain Number 1 Region: 38-320
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.04e-81
Family FCH domain 0.000000000147
Further Details:      
 
Domain Number 2 Region: 576-643
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000971
Family SH3-domain 0.0018
Further Details:      
 
Weak hits

Sequence:  HGL_H00000413625
Domain Number - Region: 433-504
Classification Level Classification E-value
Superfamily HR1 repeat 0.0175
Family HR1 repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000413625
Sequence length 809
Comment FNBP1 (Homo_sapiens) formin binding protein 1
Sequence
MSLEEPSAPRTPAAERGNVGRERQERWGPRRLSVSTSLSLQDQFDSLEKHTQWGIDLLEK
YIKFVKERTEIELSYAKQLRNLSKKYQPKKNSKEEEEYKYTSCQAFLSTLHETSDYAGQH
EVISENMTAQIMVDLARYVQELKQERKANFHDGRKAQQHMETCWKQLESSKRRFERDCKE
AERAQQYFEKMDADINVTKADVEKARQQAQIRHQMAEDSRADYSSILQKFNQEQHEYYHT
HIPNIFQKIQEMEERRIVRIGESMKTYAEVDRQVIPILGKCLDGIVAAAQAIDQKSDSQL
VIEAYKSGFEPPGDIEFEDYTQPLKRTVSNNSLSTPRADGKAELKFGGKSKGKLWPFIKK
NKLMSLLTSPHQPPPPPPASASPSAVPNGPQSPKQPKEPLSHRFNEFMNSKPKMHCFRSL
KRGGATPEDFSNLPPEQRRKKLQQKVDELNKEIQKEMDQRDAITKMKDVYLKNPQMGDPA
SLDHKLAEVSQNAERLRLEVQKFEAWLAEVEGRLPGRGEQARRQSGMYESQQPPAVRSCA
QDRESPDGSYTEEQSQESELKVQATDFDDEFDDEEPLPAIGTCKALYTFEGQNEGTISVA
EGETLFVIEEDKGDGWTRIRRSEEEEEGYVPTSYVEVYLDKNPKACSSGPGGTGAAVPTV
STRSLHISHCAFMMSLCPPVTPARALISPDTTGPRGSAEGSSVLGICTASLREAALCTGS
SCDRWTGPLMSASHRPWGTRSGFHCKPLYCLCPDEGDGASHGAQHSEPGRSPMTSEQPLA
RTPAVGSLSPGTPPRVLPAVPTPARMLQE
Download sequence
Identical sequences G5ASB4
HGL_H00000413625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]