SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000414552-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000414552-1
Domain Number 1 Region: 8-208
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.04e-50
Family Protein kinases, catalytic subunit 0.00011
Further Details:      
 
Domain Number 2 Region: 289-342
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000611
Family SAM (sterile alpha motif) domain 0.017
Further Details:      
 
Weak hits

Sequence:  HGL_H00000414552-1
Domain Number - Region: 235-275
Classification Level Classification E-value
Superfamily Tropomyosin 0.0641
Family Tropomyosin 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000414552-1
Sequence length 727
Comment MAP3K12 (Homo_sapiens) mitogen-activated protein kinase kinase kinase 12
Sequence
MSSLGTSFVQIKFDDLQFFENCGGGSFGSVYRAKWISQDKEVAVKKLLKIEKEAEILSVL
SHRNIIQFYGVILEPPNYGIVTEYASLGSLYDYINSNRSEEMDMDHIMTWAKDVAKVVIA
ADGVLKICDFGASRFHNHTTHMSLVGTFPWMAPEVIQSLPVSETCDTYSYGVRLTIPSSC
PRSFAELLHQCWEADAKKRPSFKQIISILDSMSNDASLPDQCNSFLHNKAEWRCEIEATL
ERLKKLERDLSFKEQELKERERRLKMWEQKLTEQSSTPIPQWAWAGDSSVEMSGYASLFK
ENNITGKRLLLLDEEDLKDMGIVSKGHIIHFKSAIEKLTHDYLNLFHFPPLIKDSGGEPE
ENEEKIVNLELVFGYHLKPGTGPQDCKWKMYMEMDGDEIAITYIKDVTFNTNLPDAEILK
MVKPPFVMERWIVGIAQNQTVECTVTYESDVRTPKSTKHVHSIHWSRSKPQDEVKAVQLS
IQTLLLNSEGNPRSRSDSSADCQWLDMLRMRQMASDLTLQRSHSNPILGSPFFPFFDNQD
SYAAAVRRTQAPVKYQQITPINQSRSSSPTQYGLTKNFSSLLLNSRDSGFSSLNTDSSSE
RGRYSDRGRGKRDSGSGSLNSSPRGKGQHAAAPRDRAAGRAYRVSPASLGPRQAPNSRRS
PNARRLPRPIPGMPMQPEPDPQACEEESRASEGGWTKVEPRRRPRRPSPARGGKERARVG
HRGRRTF
Download sequence
Identical sequences G5ALR2
HGL_H00000414552-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]