SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000414887 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000414887
Domain Number 1 Region: 367-424
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.29e-26
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 2 Region: 255-312
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.25e-25
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 3 Region: 199-256
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.32e-24
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 4 Region: 311-368
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.56e-24
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 5 Region: 423-480
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.46e-24
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 6 Region: 465-517
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.53e-23
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 7 Region: 161-213
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.87e-18
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Weak hits

Sequence:  HGL_H00000414887
Domain Number - Region: 1-26
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000536
Family KRAB domain (Kruppel-associated box) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000414887
Sequence length 522
Comment ZNF879 (Homo_sapiens) zinc finger protein 879
Sequence
MLENYSNLVSAGILFAKPKVISQLEQTGDPQMEGTGTPPGMCLGWESLFEATISKEENQE
AMKKFLVDHPLDFSLGKTYIDEDKLEKQQGRKNKLLRKVLVTIKNTYIKEKNFKGIELGK
SLGPKPSSLTRKPGLVSKGRKPRSQQYSILFKQLGVNTVRKCYKCNICGKIFLHSSSLSK
HQRIHTGEKLYKCKECRKAFSQSSSLTQHLRVHTGEKPYICHECGKAFSFTTSLIGHQRM
HTGERPYKCKECGKTFKGSSSLNNHQRIHTGEKPYKCNECGRAFSQCSSLIQHHRIHTGE
KPYECSHCGKAFTSISRLSRHHRIHTGEKPFHCNDCGKVFSYHSALIIHQRIHTGEKPYA
CKECGKAFSQSSALIQHQRIHTGEKPYKCDECGKAFSWISRLNIHHRIHTGEKPYHCKEC
GKAFSSHSAVNTHRKIHTGEKPYKCNDCEKAFNQSSALIQHQRIHTGEKPFSCKVCGKAF
RQSSSLMTHMRIHTGEKPYKCKECGKAFSQSSSLTNHQRTHN
Download sequence
Identical sequences G5C7C0
HGL_H00000414887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]