SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000415358-3 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000415358-3
Domain Number 1 Region: 147-204
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.28e-22
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 2 Region: 193-245
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.68e-19
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 3 Region: 101-148
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.67e-18
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 4 Region: 40-89
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000981
Family KRAB domain (Kruppel-associated box) 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000415358-3
Sequence length 247
Comment ZNF3 (Homo_sapiens) zinc finger protein 3
Sequence
MDSLPIEVEGEAMTTDASLPPKQSTEEMEPTVELRSVDLHELMTVKDEEMDFIRDKVAQL
DSAPRCLTTDIKVEDCGNLMFWDSECMPDIEEFLSKQEAYEERIHTGEKACECSECGKAF
SCRSSLIQHQRIHTGKKPYNCNEYGKAFNHHSALIQHHIIHTGEKPYECSECRKAFNQST
YLIQHHRIHTREKPYKCKECSKAFNDTSSLIKHQRVHTREEPYGCKECGKVFSDQSVLVR
HQRIHTG
Download sequence
Identical sequences G5BTW7
HGL_H00000415358-3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]