SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000416158 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000416158
Domain Number 1 Region: 68-290
Classification Level Classification E-value
Superfamily FKBP-like 1.44e-30
Family FKBP immunophilin/proline isomerase 0.00027
Further Details:      
 
Domain Number 2 Region: 350-407
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.02e-26
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 3 Region: 294-351
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.02e-23
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 4 Region: 441-487
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.53e-20
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 5 Region: 476-528
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.02e-17
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 6 Region: 396-444
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.74e-16
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 
Domain Number 7 Region: 1-32
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000157
Family KRAB domain (Kruppel-associated box) 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000416158
Sequence length 1216
Comment FKBP15 (Homo_sapiens) FK506 binding protein 15, 133kDa
Sequence
MFGAGDEDDTDFLSPRGGARLASLFGLDQPAAGHGNEFFQYTAPKQPKKGQGTTATGNQA
TPKPTPTTTDTSTVLVATAVHAYRYTNGQYVKQGKFGAAVLGNHIAREYRILLYISQQQP
VTVARIHLNFELTVQSNNYSTFYDDQRQNWSIMFESEKAAVEFNKQVCIAKCNSTSALEA
VLSQDLVVAEGSAVEVGDSLEVAYTGWLFQNHVLGQVFDSTANKDKLLRLKLGSGKVIKA
WEDGMLGMKKGGKRLLIIPPTCAAGSEGVIGWTQSPDSILVFEVEVKRVKFGRDSGSDGH
SVSSRDSAAPSPIPGVDSHSAGPVVSPPTSVPFRSGEPALRTKSNSLSEQLTINSSPDAV
KAKLISRMAKMGQPMLPILPPQLDSNDSEMEDLNTLRGPGQPLVTPPIQPSFQPAHPVLP
QMTSQAPQSSVSGLHAPSAALVQVASLDSHSVVSGNAQSFQPYAGTQAYAYPQAASVTSQ
LQPVRPLYPAPLSQPPHFQGSGDMASFLMTEARQHNTEIRMAVSKVADKMDHLMTKVEEL
QKHSAGNSMLIPSMSVTMETSLIMSNIQRIIQENERLKQEILEKSSRIEEQNDKISELIE
RNQRYVEQSNLMMEKRNNSLQTATENTQARVLHAEQEKAKVTEELAAATAQVSHLQLKMT
MHQKKETELQMQLTESLKEIDLLRGQVVKLQAELSELQETSAQAQSKFKNEKQTRKQLEL
KLTALEEELSDLRAEKESLEKNLSERKKKSAQERSQAEEEIDEIRKSYQEELDKLRQLLI
KARVSTDQAAAEQLSQVQAELQTHWEAKCEHLLASAKDEHLQQYQEVCAERDAYQQKLTY
LQEKCLALQAQVTSLIEQNEQHIKELENSKSQRSGVEVLDPSEKVKKIMNQVFQSLRGEF
ELEESYDGRTILGTIMSTIKMVTLQLLNQQEREQEESSSEEEEQPQRPSQEQSGPATPRL
SPAPLSRERQEAPVVSSEQVVEEVASSPPQTLATPQYGIQRREEASSEAEMLSETKDGFL
PPEAASIPAHRVLGPPTSIPPKPPGPITTDSECEETLAASLMTAKPDNPLGKAHVGEIAP
HGPLQESSGTLSLTPDPEKGDPPAMEPESPEGKPQPPELKGDEALASFPGPSEAPSSTES
STAAGEAALRPSHNSQHSSLSGDKEEELFQGATLKLPRPKAQPEEEDEDEVSMKGRPPPT
PLFGDDDDDDDISWLG
Download sequence
Identical sequences G5BWQ8
HGL_H00000416158 XP_004849615.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]