SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000416340-3 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000416340-3
Domain Number 1 Region: 183-299
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.36e-28
Family Canonical RBD 0.0000175
Further Details:      
 
Domain Number 2 Region: 95-183
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 5.37e-27
Family Canonical RBD 0.00000902
Further Details:      
 
Domain Number 3 Region: 7-88
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.61e-18
Family Canonical RBD 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000416340-3
Sequence length 392
Comment HNRNPA3 (Homo_sapiens) heterogeneous nuclear ribonucleoprotein A3
Sequence
MEVKPPPGRPQPDSGRRRRRRGEEGHDPKEPEQLRKLFIGGLSFETTDDSLREHFEKWGT
LTDCVVMRDPQTKRSRGFDFVTYSCVEEGHDPKEPEQLRKLFIGGLSFETTDDSLREHFE
KWGTLTDCVVMRDPQTKRSRGFGFVTYSCVEEVDAAMCARPHKVDGRVVEPKRAVSREDS
VKPGAHLTVKKIFVGGIKEDTEEYNLRDYFEKYGKIETIEVMEDRQSGKKRGFAFVTFDD
HDTVDKIVVQKYHTINGHNCEVKKALSKQEMQSAGSQRGRGGGSGNFMGRGGNFGGGGGN
FGRGGNFGGRGGYGGGGGGSRGSYGGGDGGYNGFGGDGGNYGGGPGYSSRGGYGGGGPGY
GNQGGGYGGGGGYDGYNDEGGFGGGLLGFCVQ
Download sequence
Identical sequences G5BTZ8
HGL_H00000416340-3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]