SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000416797 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000416797
Domain Number 1 Region: 815-948
Classification Level Classification E-value
Superfamily PRC-barrel domain 2.12e-57
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.000000284
Further Details:      
 
Domain Number 2 Region: 176-260
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000158
Family Calponin-homology domain, CH-domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000416797
Sequence length 954
Comment KIAA1543 (Homo_sapiens) KIAA1543
Sequence
MKPPVTRLLLSAELYCRAWRQALTQLEAPPNPSALLALLSRRGTVPSLPDRPVREADLRQ
QPILMGAHLAVIDALMVAFAFEWTKTLPGPLALPNLEHKLLFWVETNVRGLQEKTEQEAA
QRVSPAAPADGAAPAQPSHAIAFCLKESGSKPPMIRYRKDRATARRAPCFPSVTTVQDLA
SGAALAATIHCYCPQLLRLEEVCLKDPMSVADSLYNLQLVQDFCASRLPRGCPLSLEDLL
YVPPPLKVNLVVLLAEMFMCFEVLKPDFVQAKDLPDGHAASPRGTEASPSQNNSGSSSPV
FNFRHPLLSPGGSQSPLRGSTGSLKSSPSMSHMEALGKAWNRQLSAEPRLLPDGAADGSF
YLHSPEGPSKPPLSSSYPPMGASKLLSDGLPKAPVYVSHPEVPSKSSPCPAGEELKPPAP
AEGSPKAVALSPAATNSEVKMTSFAERKKQLVKAEVEVGVASPTATPVAPEALSSEMSEL
GARLEEKRRAIEAQKRRIEAIFAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGPNP
TSRSPKHARPAELRLAPLTRVLTPPNDVDSLPHLRKFSPSQVPVQTRSSILLSEGTPPEE
PTPRPGLIEIPLASLGEPAAEDERDGSPPGAEDSLEEEALSEGEPRTGLGFFFKDEDKPE
DEMAQKRASLLERQQRRAEEARKRRQWQEAEKEQRREEPEPSAKSNKFIIHNALSHCCLA
GKVNEPQKNRVLEEIEKSKANHFLILFRDSSCQFRALYTLSGETEELSRLAGYGPRTVTP
TMVEGIYKYNSDRKRFTQIPAKTMSMSVDAFTIQGHLWQSRKPTTPKKGGGTPK
Download sequence
Identical sequences G5B7I3
HGL_H00000416797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]