SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000416826 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000416826
Domain Number 1 Region: 1023-1059,1140-1235,1337-1583,1632-1664
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.78e-38
Family Tandem AAA-ATPase domain 0.069
Further Details:      
 
Domain Number 2 Region: 7-120
Classification Level Classification E-value
Superfamily TPR-like 1.72e-16
Family Tetratricopeptide repeat (TPR) 0.0026
Further Details:      
 
Domain Number 3 Region: 433-583
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000301
Family Ankyrin repeat 0.0085
Further Details:      
 
Domain Number 4 Region: 219-340
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000032
Family Ankyrin repeat 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000416826
Sequence length 2918
Comment TRANK1 (Homo_sapiens) tetratricopeptide repeat and ankyrin repeat containing 1
Sequence
MDPAVYAELLKESGNQVLKNGNFSLAIRKYDEAIHILLQLYQWGIPPRELAVLLCSKSNA
FYSLGKWNEAFLTAKECLQWDPTYVKGYYRAGYSLLRLLQPYEAARMFFEGLRLLQSSED
QTQVPNFLVGIFTTMSSDSIVLQSFLPCFDHIFTTGFSTEVWQCVIEKLAKKGLWHSFLL
LSAKKDRLPGDIHVPELSLKNLFQKYVFIGLYEKMEQVPKLVQWLISIGASIETIGPYPL
HALMQLCIQAGENQLFRWLMDHEPEWKSHINQKDEDGCTVLHVVAAHSPGYHIKRQTEDV
QMLLHFGADPTLLDRQSRSAVDVLKRNKNFRAIEKINSHLEKLATSSKDLPGVFFLFLEE
IPSDLIFDINQDCTNTFIKLLLKRKRWLEVLLLLTRKISGEPPLGDCFLKDCNLLDLDIC
TIIPHLRTWDQRKTQLLGLLIDNGALPEGLQGSQQKPILMCLQNEEFELAFLLLTKGADP
RDISLMEGDTPLHAALHIFLDINADIGFNFLSYLLDLFLSNPTEFYYLDPNVQDSNGNTL
MHILFQKGMLKRMKKLIELLVKFNINFNLKNKEGKDVRHRIKKNDALLVTWNKALEDSRR
KGRQDSAAHQGKLSRSSAPGHTSQLKFQDSFKSLPCGATMGTLSEEATIPGSWEILPDVQ
VTRQEPEATKPHSLRDHLVQDITILMEQVELDMSFPEDYPQHSEPLEVEAGMEGKKDKFQ
HTLSMGISDCNGSNPAVSEPGEGHAQAGLGASQLVPTGSRGSVGSDDQDSFSMQEIEACL
QDFDNMTWEIECTSEMLKKLSSKVMTKVIKKKIIFAIQQLGNGEWTHGLQKRLKHLKGNI
QLFEAKLDKGARMLWELAIDFSPRCSENPEKIIATERNTYSMEKSGRVYTEIIRIWDIVL
DHCKLSDSIMAICSAYNRGLSCVLRKKLKGINKGQVLANKKIQKHIPRCYVEDTEAEKSK
ECKDPEYFPPASAVETEYNIMKFHSFSTNMAFNILNDMTVTVEYPFRVGELEYAVIHLNP
KPLEPIILIGRSGTGKTTCCLYRLWKKFHIYWEKADQAGSPLLAKQTWPKRRLEMGPRKE
GPIREGDEEDEEEKGSSEVETVDCIEEKQESEACLGGAHEKATGDSQVAEGCVSEHPHQL
EHLHQIFVTKNHVLCQEVQRNFIELSKSTKATGHYKPLEPNVHKLQDLRDENFPLFVTSK
QLLLMLDASLPKPFFLRNEDGSLKRNIVGWSTQEDLTISNWQDDEEEAEADGDYSEEDKT
IETRTGDSDPRIYVTFEVFTNEIWPKMTKGKSSYNPALIWKEIKSFLKGSFEALSCPHGS
LTEEAYKKLGRKRSPNFKEDRSEIYSLFCLYQQIRSQKGYFDEEDVLYNLSQRLLKLKVL
PWSIHELYGDEIQDFTQAELALLMKCINDPNAMFLTGDTAQSIMKGVAFRFSDLRSLFHY
ASRSTVDKQCVVRKPKRIHQLYQNYRSHSGILNLASGVVDLLQFYFPESFDRLPRDSGLF
DGPKPTVLESCSVSDLAILLRGNKRKTQPIEFGAHQVILVANEMAKEKIPEELGLALVLT
VYEAKGLEFDDVLLYNFFTDSEAYKEWKIISSFIPSSFDSRVGNWPLVEVPLEKPSSQAR
SLTVNPEMYKLLNGELKQLYTAITRARVNLWIFDENLEKRAPAFKYFIRRGFVQVVKTDE
NKDFDDSMFVKTSTPEEWIEQGEYYAKHQCWKVAAKCYQKGGAFEKEKLALAHNTALNMK
SKKVSPKQKQLEYLGLAKTYLECNEPKLSLKCLSYAKEFQLSAQLCERLGKIRDAAYFYK
RSQCYKDAFRCFEQIQEFDLALKMYCQEELFEEAAIAVEKYEEMLKTKTLPISKLSYSAS
QFYVEAAAKYLSANKIKEMMTVLSKLDIEDQLVFLKSRKCLAEAADLLKGRREEAALLMK
QHGCLLEAARLTADKDFQASCLLEVARLNVARDSDIEQTKAILQEALDLCYQTGQFSGIA
EAQFLQGVILRDFQKLKDAFLRFETLNHSAGVVEALYEAARQCEADPEKVLALAPWGLEV
LLNLVKALKRVTNNAEKEMVKSCFEFFGISQVDAKYCQIAQNDPGPILRIIFDLDLNLRQ
KTTKDYFLIMTDQVKLALNKHLLSRLCQITQSLLGKTYPGICLKFIVGLKCEDKNCEDFH
RPLRRCEAKCMVQSKMHLVAISGLLLEAKNIFSQILAEELEEIDYILSADIYGLCKSFLN
VLFPRHFHQRVLSENPMACKEILKPHYKSFRPYRFALKEYIHDLFQNETPCSRRESTDLW
LSAMHAFLISSSYPEEFEKLLHQEEDNYNRELKALESEKEERGRGKSNKMKGIEGKFGML
VPNKDDESAEKNHLCFIRLLENCIDQLYVYRNPEDYKKLFFRFMNVLIQRCKEPLIPSIG
NTVALLEFQFIHCSVVLARLWKNAILCLPKSYIALLHYWGFLFSKKDKELGDTFSIIQEY
KPKDVTRAIQDFRFHLSYLVKVLCGYENMNFNVLLDAFSEIDYVVSGEAERTLVLCLVML
LNAEGFLQPFCKPLLYRHFQEIETRLQLMSMDFPDQVPERLQKAVRRVVMAVNVKFVAEA
LQDLLFERDEEFLMDCHWQWDSVHTKGSVIHGLCHEEVRLSRLLCVGPVDYFAEPECEFG
EDETDELVLEDRDYLLATILSLKQRKASIQRKLRRICLVVSLCISWRRWVQTKHDREEPR
EPRAGNFKKADVDRTQCDLCGVKFTRNPDNYFSPSKAFEEVASGAVILSRLELEGKECWE
RSSESYEQHIHLESHQRQQVAYQKYSEFFYEKVDPAIYEGKLVVQDIEQSRWIRSHLGSK
EHSHMLQRKIQEHIKRVSELVEDRYRRKAWAGAEEVLTRLVVILIMSVKDAQEWLMKTEL
HLKEEGIVQDDDYENEAEDFGELRPRRRSRKCGKQRKY
Download sequence
Identical sequences G5BR59
HGL_H00000416826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]