SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000417273-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000417273-2
Domain Number 1 Region: 4-63
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000063
Family SH3-domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000417273-2
Sequence length 122
Comment NCK1 (Homo_sapiens) NCK adaptor protein 1
Sequence
MAEVVVVAKIDYVAQQEQELDIKKNESLWLLGDSKSWQRVRNSMNKTGFAPSNHVERKNS
APKASIVKNLKDTLGIGKVNKKTPSVPDSESPADDSFVNPGEHLYDLNMPAYVKFNYMAE
RG
Download sequence
Identical sequences G5B4L4
HGL_H00000417273-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]