SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000417470 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000417470
Domain Number 1 Region: 602-658
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.7e-21
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 519-575
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.58e-20
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 3 Region: 463-519
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.41e-19
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 4 Region: 113-169
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.57e-18
Family KRAB domain (Kruppel-associated box) 0.0027
Further Details:      
 
Domain Number 5 Region: 643-695
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.1e-17
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 6 Region: 413-463
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000508
Family Classic zinc finger, C2H2 0.033
Further Details:      
 
Domain Number 7 Region: 335-392
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000349
Family Classic zinc finger, C2H2 0.032
Further Details:      
 
Domain Number 8 Region: 287-349
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000302
Family Classic zinc finger, C2H2 0.04
Further Details:      
 
Domain Number 9 Region: 565-596
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000112
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Weak hits

Sequence:  HGL_H00000417470
Domain Number - Region: 401-417
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0511
Family Classic zinc finger, C2H2 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000417470
Sequence length 727
Comment ZNF786 (Homo_sapiens) zinc finger protein 786
Sequence
MLCAPSLGLGPPRIVLGCGRLSVGDSRGGARDGWPLVGCGDREGHGRAGSGGRHAWRQTP
GEPVSRPENKAERGPRPRRRGAPERITQPTFSGIQSPGLKDLKFQELGVMFLPLTFEDVA
IYFSEQEWQDLEMWQKELYKGVMRTNYETLVFLDGALSKPELISWIEQGREPFRSWGESQ
PPGNMALPSADLHFDPVIGGDHQAVKSRETKCHFQLDPLQSPSSSFESKLLGERPDPALN
RPSPKRQNTRALPAVTSESAQKERIPSHSVLGFPGSEEAPSRQSTQHPCSAFGESFWEKN
HLVRHQRSHSKDLSPRDRAWRRAQGRFFCPECRQSFRLQRCLWRHLAAHGRKSPFQCPQC
KLCFHQEQTPLSHSLGHKREKPSHCRKCGEGFTTQCAIKERPFPCAQCSRSFRQQGQQLH
TVEKPFQCPQCTLSFCLPSALSTHARQHCREWPFSCGECGRGFAHPCKLREHLRVHSGER
PFACPECGKCFRLKGILKAHQRIHSAERPFSCPQCAKGFARQSKLTEHLRVHSGERPFRC
PECDRGFRLKGQLVSHQRLHTGERPFRCPECDKCYRVKADMKAHQLLHRGKMPFSCACGK
GFAKQSKLTEHVRTHTGEKPFQCPTCDKRFRLKAQLLSHQGLHTGERPFRCPECDKNFRE
RGHMRRHQRIHRPERPFACDDCGKGFIYKSKLAEHIRVHAKACPAPSESDIKKRLSQLFA
MIEADWS
Download sequence
Identical sequences G5BET0
HGL_H00000417470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]