SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000417515 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000417515
Domain Number 1 Region: 258-428,463-629
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.43e-72
Family YicI catalytic domain-like 0.0019
Further Details:      
 
Domain Number 2 Region: 1099-1291,1335-1496
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.5e-68
Family YicI catalytic domain-like 0.00036
Further Details:      
 
Domain Number 3 Region: 27-257
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 3.01e-46
Family YicI N-terminal domain-like 0.012
Further Details:      
 
Domain Number 4 Region: 874-1098
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 2.29e-26
Family YicI N-terminal domain-like 0.019
Further Details:      
 
Domain Number 5 Region: 1499-1579
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 1.29e-18
Family Putative glucosidase YicI, domain 3 0.0046
Further Details:      
 
Domain Number 6 Region: 632-712
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 9.35e-16
Family Putative glucosidase YicI, domain 3 0.018
Further Details:      
 
Domain Number 7 Region: 844-897
Classification Level Classification E-value
Superfamily Trefoil 0.0000000000523
Family Trefoil 0.0047
Further Details:      
 
Domain Number 8 Region: 2091-2170
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000267
Family V set domains (antibody variable domain-like) 0.0000746
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000417515
Sequence length 2171
Comment MGAM (Homo_sapiens) maltase-glucoamylase (alpha-glucosidase)
Sequence
MVVQYSLPDICRRQYKCCWDPVADTNAPKCFFPRNWGYEVSSGLRNTSTGFTAQLKKVPS
PSLFGNDVTDVLFTAEFQTSNRFRFKITDANEIRYEVPHENIKPSNGTADTSGLSYHIEV
TNKPFSIKVMRMSNKKVLLDTGIGPLQFAYQYLQLSFRLPSTYVYGLGEHVHQQYHHNMS
WKAWPIFTRDATPTAGLINLYGAHTFFLCLEDTSGFSFGVFLMNSNAMEVALQPAPAITY
RTIGGILDFYVFLGNTPEQVVQEYLELVGRPFLPAYWSLGFQLSRRNYGGINGLKEVVNR
NREAGIPYDVQYSDIDYMDGKKVFTIDEQAYYNLSGFAEELHNNGQKYIIIMNPGIFKDP
NYMTYNNGSIKRVWILESKGFAVGQGYPGKVVFPDFSNPVCTQWWTEQFTDFHNHLKFDG
VWIEMDEVSSFLQDSDQQCESNILNFPPFTPNILDGLLSARTLCMDTEFHRGFHYDVHSL
YGYSMARATDVAMDTIFPSTRNFILSRSTFAGSGKFAAHWLGDNAATWDDLRWSIPSILE
FNLFGIPMIGANICGYTRNVTEELCRRWMQLGAFYPLSRNHNGPGFRDQDPAAFGFDSLL
LSSSRHYLNIRYTLLPYLYTLFYRAHTLGETVARPLVHEFYQDTMTWKVHEQFLWGPGLL
ITPVLYEGVDRVKAYIPDAIWYDYETGMAVQWRKQFVDMLLPGDRIGLHLRGGYIFPTQQ
PNTTTETSRKNSLGLIVALDYKREAKGELYWDDGVAKDAVAEKKYILYDFSISSNRLQAR
ITHNNYMDPNNLMFTDIRILGMDKEPTNFIILSNNAPTPISSIVYNASVQMVTISDLKGL
FLGQEFSIEWKLPVSDLEKFSCYPEDSFASEESCRQRGCLWEHTTTPGVPVCFYDTIPRY
AASNIQYLRTGITTDLIFLVTPTSAQVAAAPLSPAAASVVSGPLSVEISSLKLSVVYHTE
NMLQVKIYDSTNKRYEVPVPLNTPPSPVDSLKNCLYDVRIQTTPFGIQVLRKSSGTVIWD
SQLPGFTFNDMLLSISTRLPSQYIYGFGETEHMTFRRNMSWNMWGMFARDEPPGYKRNSY
GVHPYYMALEEDGSAHGVXLIGRPAMIPYWALGFQLSRHGYQSDSEISSLYDAMVAAQIP
YDVQHVDIDYMDRKLDFTLSPSFQNLGILIEQMKKNGTRFILILDPAISGNETHYLTFTR
GQEDNVFIKWPDTNDVVWGKVWPELPNVNIDESLDHETQVKLYRAHVAFPDFFCNSTTTW
WKKEIQELYANPREPAKSLKFDGLWIDMNEPSNFMDGSVEGCHNEVLNNPPFMPYLASRD
RGLSSKTLCMESEQILPDGSRVHHYDVHSLYGWSQTRPTYEAVQDTTGQRGIVITRSTFP
SSGRWAGHWLGDNTAAWDQLGKSIIGMMQFSLFGISYTGADICGFFGDAEYEMCVRWMQL
GAFYPFSRNHNTIGTRRQDPVAWNSTFEMFSRKVLQTRYTLLPYLYTLMHKAHAEGSTVI
RPLLHEFTDDRSTWNIDHQFMLGPAVLVSPVLQSNTFEIWAYFPRARWYDYSTESGHEST
GVWEILKAPLDHINLHVRGGYILPWQEPAINTHFSRQNFMGLTVALDDDGKAEGQMFWDD
GQSIDTYENGNYFLANFTAAENILHIQVIHNKYLSDSNPLKVGYIKVWGVNSTYVTQVKF
TYDNQQFTETNLKSDPSNQTLTIQLTDKNINLEKLTEVIWIHDDPVVTSPTMTSTSTMST
HPFPSTTEATSAETIISSGSASTTVSTITMVSITNTPSASSAHVTTTPVIPDTTPFHTSP
MSTIPFPKNATNVTTSTPAPGITTPFPSTVSTSAVVPVTTIPFPTNISSVISSASPDTTP
FTTNVSTSTTIPLSTIPFPTNTTNVTSSTIALGTTPFPTNMSTSTTIPLSTIPFSTNTTD
VTASTPAPDITTPFPSTMSTSAVVPVTTIPFPTNISSVTTSTIAPDTTPFPTTVRTGTIV
SLSTIPFPTNTTNVTTSTNGFGTSPFPTTVSTSTTVPLSTIPFPTNTTNVTSSTIALGTT
PFPTNMSTSTTIPLSTIPFSTNTTNVTTSSTAPDTTPLPTTVSTNATASLVEQRPRWALV
QAGQEETLRCILRNSQYPWMSWYQQDLQQQLQFLVTLWTPGDEKTISLPGADYLATRVSD
TELRLRAANVT
Download sequence
Identical sequences HGL_H00000417515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]