SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000417839 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000417839
Domain Number 1 Region: 385-560
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 1e-30
Family RNA editing terminal uridyl transferase 2, RET2, domain 2 0.023
Further Details:      
 
Domain Number 2 Region: 160-230,314-380
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 1.31e-25
Family Catalytic subunit of bi-partite nucleotidyltransferase 0.081
Further Details:      
 
Domain Number 3 Region: 54-133
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000000611
Family Canonical RBD 0.0041
Further Details:      
 
Domain Number 4 Region: 5-46
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000205
Family Classic zinc finger, C2H2 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000417839
Sequence length 833
Comment EEF1G (Homo_sapiens) terminal uridylyl transferase 1, U6 snRNA-specific
Sequence
MAAVDSDVESLPRGGFRCCLCHVTTANRPSLDAHLGGRKHRHLVELRAARKAQGLRSVFV
SGFPRDVDSTELSEYFQAFGPVASVVMDKDKGVFAIVEMGDMGSRDAALAQPQHSLRGQR
LRVRPREQKAFQSPGSRALRGAAPEDSGQLLSALAEAPDVGTQMMKLVALRELSEAERQL
RCLVVALMQEVFTEFFPGCAVHPFGSSTNSFDVHGCDLDLFLDLGELDEPQACTPASPAD
SQPPTSPQDSEALDFEALSSLAPQTPDSALASEILASPQSLPPASPLQEDRGEGDPGKAP
DAAEALGGEKPAGAAMLELVGSILRRCVPGVYRVHSVPSARRPVVKFCHRPSGLHGDVSL
GNRYLGGLALHNSQFLSLCAELDGRVRPLVYTVRCWAQGRGLAGSGPLLSNYALTLLVVY
FLQTRDPPVLPTVAQLTRKADEGERVEVDGWDCSFPRDARSLEPSANVEPPGALLAQFFF
CVSCWDLRGSLLSLREGRALPVAGGQPAIFWEGLRLGPMNLQDPFELSHNVAANVTSRVA
GRLQNCCRAAASYCRSLQYLRRSARGRDWGLLPLLQSSSPASLLAATPIPLPVVPFPQLC
TALVRVLRDALGCQVEQGTKRPRPKAGMEEAAQGGAGKRLKLDGHGEGGEDRAEEPWGHA
GDLHGEVVEEMVVEVGETVPDSAMWSPGQAGDPPGVAGHREGPDHPAQAQPRPSCASWRC
ALWHRTWQGRRRARRRLQQQQQQQQQREGQRGDAGAGWLATEAQVTQELARPSGGERGAG
AEPLVAFMASASASEAEGMLSVTPLRDAQGLFPELHHFLQGFVPQALRQAIKQ
Download sequence
Identical sequences G5AYH3
HGL_H00000417839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]