SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000417914 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000417914
Domain Number 1 Region: 39-281
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.9e-50
Family Ankyrin repeat 0.00015
Further Details:      
 
Domain Number 2 Region: 280-322
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000085
Family SOCS box-like 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000417914
Sequence length 323
Comment ASB11 (Homo_sapiens) ankyrin repeat and SOCS box-containing 11
Sequence
MEDGPVFYGFKNIFITMFAIFFFFKLLIKVFLALLTHFYIVKGNRKEAARIAEEIYGGIS
DCWADRSPLHEAAAQGRLLALKTLITQGVNVNLVTINRVSSLHEACLGGHVACAKVLLEN
GAQVNAVTVHGATPLFNACCSGSAACVNVLLEFGAKAQLEVHLASPIHEAVKRGHRECME
ILLVNNVNIDQEVPQLGTPLYVACTYQRVDCVRKLLELGASVDNGQWMDTPLHAAASQSS
AEIIHLLTDYGATLKLRNAQGKRALDLAAPQSSVEQALLLREGPPGLSQLCRLCVRKCLG
RACHQAVYKLCLPEPLERFLLYQ
Download sequence
Identical sequences G5C239
XP_004866141.1.39548 HGL_H00000417914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]