SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000417980-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000417980-2
Domain Number 1 Region: 1031-1289
Classification Level Classification E-value
Superfamily SET domain 9.68e-86
Family Histone lysine methyltransferases 0.0000322
Further Details:      
 
Domain Number 2 Region: 754-1011
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.78e-58
Family Ankyrin repeat 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000417980-2
Sequence length 1329
Comment EHMT1 (Homo_sapiens) euchromatic histone-lysine N-methyltransferase 1
Sequence
MSSVSATKSLLPPARTPKPAPKPPPPPPLPPPLLRPVKLEFPLDEDLELKAEEEDEDEDE
DVSDICIVKVESALEVAHRLKPPGGLGGGLGIGGSVSGHLGELAQSSVAPSTVAPPQGVG
DTPAEMGALLLEKEPRGAPERVHGSLGDTPHSEETLPKANPDSMEPAGPSSPASVTVTVG
DEGSDTPVGATPIIGDEPENLEGDGSRVLLGHATKSFPSSPSKGGACASRAKMSMTGAGK
SPPSVQSLAMRLLNMPGAQGLAASGPEPTPATTVSSEGQPKVHRARKTMAKPGNGQPPVP
EKRPPEVQHFRMSDDVHSLGKVTSDVAKRRKLNPGGGLSEELGSTRGSGEVTLDKGDPRS
LEEWETVVGDDFSLCYDSYSVDERVDSDSKSEVEALAEQLSEEEEEEEEEEEEEEEEEEE
EEEEDEESGNQSDRSGSSGRRKAKKKWRKDSPWVKPSRKRRKREPPRAKEPRGVNGVGPS
GPSEYMEVPLGSLELPGEGTLSPNHAGVSNDTSSLETERGFEELPLCSCRMEAPKIDRIS
ERAGHKCMATESVDGELSGCNAAILKRETMRPSSRVALMVLCETHRARMVKHHCCPGCGY
FCTAGTFLECHPDFRVAHRFHKACVSQLNGMVFCPHCGEDASEAQEVTIPRGDGGTPPAG
TVAPAPPPLAPDAPGRADASQPSARMRGQGEPRRPPCDPLADTIDSSGPSLTLPSGGCLS
AVGLPLGPGREALEKALVIQESERRKKLRFHPRQLYLSVKQGELQKVILMLLDNLDPNFQ
SDQQSKRTPLHAAAQKGSVEICHVLLQAGANINAVDKQQRTPLMEAVVNNHLEVARYMVQ
RGGCVYSKEEDGSTCLHHAAKIGNLEMVSLLLSTGQVDVNAQWAVAPPHHVLPARTHRTA
AGGHPSSIIWAAEHKHIDVIRMLLTRGADVTLTDNEENICLHWASFTGSAAIAEVLLNAR
CDLHAVNYHGDTPLHIAARESYHDCVLLFLSRGANPELRNKEGDTAWDLTPERSDVWFAL
QLNRKLRLGVGNRAIRTEKIICRDVARGYENVPIPCVNGVDGEPCPEDYKYISENCETST
MNIDRNITHLQHCTCVDDCSSSNCLCGQLSIRCWYDKDGRLLQEFNKIEPPLIFECNQAC
SCWRNCKNRVVQSGIKVRLQLYRTAKMGWGVRALQTIPQGTFICEYVGELISDAEADVRE
DDSYLFDLDNKDGEVYCIDARYYGNISRFINHLCDPNIIPVRVFMLHQDLRFPRIAFFSS
RDIRTGEELGFDYGDRFWDIKSKSSPCQCGSEKCKHSAEAIALEQSRLARLDPHPELLPE
LSSLPPVNT
Download sequence
Identical sequences G5C3G9
HGL_H00000417980-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]